BLASTX nr result
ID: Mentha28_contig00010455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00010455 (515 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004233436.1| PREDICTED: aspartic proteinase PCS1-like [So... 103 2e-20 ref|XP_006360220.1| PREDICTED: aspartic proteinase PCS1-like [So... 100 2e-19 emb|CBI31649.3| unnamed protein product [Vitis vinifera] 96 5e-18 ref|XP_002283126.1| PREDICTED: aspartic proteinase nepenthesin-2... 96 5e-18 emb|CAN70318.1| hypothetical protein VITISV_016757 [Vitis vinifera] 96 5e-18 ref|XP_007206819.1| hypothetical protein PRUPE_ppa025962mg, part... 95 9e-18 ref|XP_006381198.1| hypothetical protein POPTR_0006s08790g [Popu... 94 3e-17 ref|XP_006387010.1| hypothetical protein POPTR_2222s00200g [Popu... 94 3e-17 ref|XP_007140512.1| hypothetical protein PHAVU_008G118900g [Phas... 93 4e-17 ref|XP_004514393.1| PREDICTED: aspartic proteinase PCS1-like [Ci... 93 4e-17 gb|EYU19926.1| hypothetical protein MIMGU_mgv1a026057mg, partial... 92 6e-17 ref|XP_002271077.2| PREDICTED: aspartic proteinase nepenthesin-1... 92 7e-17 emb|CBI30526.3| unnamed protein product [Vitis vinifera] 92 7e-17 ref|XP_004307483.1| PREDICTED: aspartic proteinase PCS1-like [Fr... 92 1e-16 ref|XP_006480872.1| PREDICTED: aspartic proteinase PCS1-like [Ci... 91 1e-16 ref|XP_006429126.1| hypothetical protein CICLE_v10011788mg [Citr... 91 1e-16 ref|XP_003530215.1| PREDICTED: aspartic proteinase PCS1-like [Gl... 90 4e-16 ref|XP_002458751.1| hypothetical protein SORBIDRAFT_03g039590 [S... 89 6e-16 ref|XP_004970553.1| PREDICTED: aspartic proteinase PCS1-like [Se... 89 8e-16 ref|XP_002531560.1| Aspartic proteinase nepenthesin-2 precursor,... 89 8e-16 >ref|XP_004233436.1| PREDICTED: aspartic proteinase PCS1-like [Solanum lycopersicum] Length = 429 Score = 103 bits (257), Expect = 2e-20 Identities = 45/64 (70%), Positives = 56/64 (87%) Frame = -1 Query: 197 AKQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPL 18 AK+ PS S +PPNK++FHHNVSLTVS+S+G+PPQ MVLDTGSELSW+HC+KTP+TPL Sbjct: 34 AKKTPSISASKPPNKVAFHHNVSLTVSLSIGSPPQQVVMVLDTGSELSWVHCKKTPTTPL 93 Query: 17 SFSP 6 F+P Sbjct: 94 IFNP 97 >ref|XP_006360220.1| PREDICTED: aspartic proteinase PCS1-like [Solanum tuberosum] Length = 429 Score = 100 bits (249), Expect = 2e-19 Identities = 44/63 (69%), Positives = 54/63 (85%) Frame = -1 Query: 194 KQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLS 15 K+ S S P+PPN+++FHHNVSLTVS+S+G+PPQ MVLDTGSELSWLHC+KTP TPL Sbjct: 35 KKTASISSPKPPNRVAFHHNVSLTVSLSIGSPPQQVVMVLDTGSELSWLHCKKTPITPLI 94 Query: 14 FSP 6 F+P Sbjct: 95 FNP 97 >emb|CBI31649.3| unnamed protein product [Vitis vinifera] Length = 761 Score = 95.9 bits (237), Expect = 5e-18 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 9 +PS S+PRP +KLSFHHNVSLTVS++VG+PPQ TMVLDTGSELSWLHC+K P+ F Sbjct: 355 LPSGSVPRPSSKLSFHHNVSLTVSLTVGSPPQTVTMVLDTGSELSWLHCKKAPNLHSVFD 414 Query: 8 P 6 P Sbjct: 415 P 415 >ref|XP_002283126.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 436 Score = 95.9 bits (237), Expect = 5e-18 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 9 +PS S+PRP +KLSFHHNVSLTVS++VG+PPQ TMVLDTGSELSWLHC+K P+ F Sbjct: 43 LPSGSVPRPSSKLSFHHNVSLTVSLTVGSPPQTVTMVLDTGSELSWLHCKKAPNLHSVFD 102 Query: 8 P 6 P Sbjct: 103 P 103 >emb|CAN70318.1| hypothetical protein VITISV_016757 [Vitis vinifera] Length = 429 Score = 95.9 bits (237), Expect = 5e-18 Identities = 43/61 (70%), Positives = 51/61 (83%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 9 +PS S+PRP +KLSFHHNVSLTVS++VG+PPQ TMVLDTGSELSWLHC+K P+ F Sbjct: 36 LPSGSVPRPSSKLSFHHNVSLTVSLTVGSPPQTVTMVLDTGSELSWLHCKKAPNLHSVFD 95 Query: 8 P 6 P Sbjct: 96 P 96 >ref|XP_007206819.1| hypothetical protein PRUPE_ppa025962mg, partial [Prunus persica] gi|462402461|gb|EMJ08018.1| hypothetical protein PRUPE_ppa025962mg, partial [Prunus persica] Length = 431 Score = 95.1 bits (235), Expect = 9e-18 Identities = 42/64 (65%), Positives = 53/64 (82%) Frame = -1 Query: 194 KQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLS 15 +QIPS SLP+ PN+L FHHNV+LTVS++VGTPPQ +MV+DTGSELSWLHC KT + + Sbjct: 36 QQIPSGSLPKSPNRLPFHHNVTLTVSIAVGTPPQNVSMVIDTGSELSWLHCNKTRNFNTT 95 Query: 14 FSPS 3 F P+ Sbjct: 96 FDPT 99 >ref|XP_006381198.1| hypothetical protein POPTR_0006s08790g [Populus trichocarpa] gi|550335806|gb|ERP58995.1| hypothetical protein POPTR_0006s08790g [Populus trichocarpa] Length = 305 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 9 IPS S+PR PNK FHHNVSL VS++VGTPPQ +MV+DTGSELSWLHC KT S P +F Sbjct: 55 IPSGSVPRSPNKPPFHHNVSLIVSLTVGTPPQNVSMVIDTGSELSWLHCNKTLSYPTTFD 114 Query: 8 PS 3 P+ Sbjct: 115 PT 116 >ref|XP_006387010.1| hypothetical protein POPTR_2222s00200g [Populus trichocarpa] gi|550304072|gb|ERP45924.1| hypothetical protein POPTR_2222s00200g [Populus trichocarpa] Length = 416 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 9 IPS S+PR PNK FHHNVSL VS++VGTPPQ +MV+DTGSELSWLHC KT S P +F Sbjct: 23 IPSGSVPRSPNKPPFHHNVSLIVSLTVGTPPQNVSMVIDTGSELSWLHCNKTLSYPTTFD 82 Query: 8 PS 3 P+ Sbjct: 83 PT 84 >ref|XP_007140512.1| hypothetical protein PHAVU_008G118900g [Phaseolus vulgaris] gi|561013645|gb|ESW12506.1| hypothetical protein PHAVU_008G118900g [Phaseolus vulgaris] Length = 440 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/61 (68%), Positives = 49/61 (80%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 9 IPS LPRPPNKL F+HNVSLT+S++VGTPPQ +MV+DTGSELSWLHC T + PL Sbjct: 43 IPSGYLPRPPNKLRFNHNVSLTISITVGTPPQNVSMVIDTGSELSWLHCNNTNTNPLIPD 102 Query: 8 P 6 P Sbjct: 103 P 103 >ref|XP_004514393.1| PREDICTED: aspartic proteinase PCS1-like [Cicer arietinum] Length = 452 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/61 (68%), Positives = 48/61 (78%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 9 IPS LPRPPNKL FHHNVSLTVS++VGTPPQ T+V+DTGSELSWLHC + +S Sbjct: 49 IPSGYLPRPPNKLRFHHNVSLTVSITVGTPPQNVTLVIDTGSELSWLHCSNNTTNRVSSD 108 Query: 8 P 6 P Sbjct: 109 P 109 >gb|EYU19926.1| hypothetical protein MIMGU_mgv1a026057mg, partial [Mimulus guttatus] Length = 395 Score = 92.4 bits (228), Expect = 6e-17 Identities = 40/52 (76%), Positives = 49/52 (94%) Frame = -1 Query: 161 PNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFSP 6 PNKLSFHHNV+LTV+++VG+PPQ TMVLDTGSELSWL+C+KTP+TP SF+P Sbjct: 10 PNKLSFHHNVTLTVALAVGSPPQQVTMVLDTGSELSWLNCKKTPTTPSSFAP 61 >ref|XP_002271077.2| PREDICTED: aspartic proteinase nepenthesin-1-like [Vitis vinifera] Length = 458 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/62 (67%), Positives = 49/62 (79%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 9 +PS S PR PNKL FHHNVSLTVS++VGTPPQ +MVLDTGSELSWL C KT + +F Sbjct: 65 VPSGSFPRSPNKLHFHHNVSLTVSLTVGTPPQNVSMVLDTGSELSWLRCNKTQTFQTTFD 124 Query: 8 PS 3 P+ Sbjct: 125 PN 126 >emb|CBI30526.3| unnamed protein product [Vitis vinifera] Length = 379 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/62 (67%), Positives = 49/62 (79%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 9 +PS S PR PNKL FHHNVSLTVS++VGTPPQ +MVLDTGSELSWL C KT + +F Sbjct: 48 VPSGSFPRSPNKLHFHHNVSLTVSLTVGTPPQNVSMVLDTGSELSWLRCNKTQTFQTTFD 107 Query: 8 PS 3 P+ Sbjct: 108 PN 109 >ref|XP_004307483.1| PREDICTED: aspartic proteinase PCS1-like [Fragaria vesca subsp. vesca] Length = 430 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/61 (65%), Positives = 51/61 (83%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 9 + +++LP+P NKLSFHHNV+LT+S++VG PPQ TMVLDTGSELSWLHC+KTP F+ Sbjct: 34 LKTQTLPKPSNKLSFHHNVTLTISLTVGLPPQNVTMVLDTGSELSWLHCKKTPILTNVFN 93 Query: 8 P 6 P Sbjct: 94 P 94 >ref|XP_006480872.1| PREDICTED: aspartic proteinase PCS1-like [Citrus sinensis] Length = 443 Score = 91.3 bits (225), Expect = 1e-16 Identities = 44/65 (67%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -1 Query: 194 KQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTP-STPL 18 ++IPS S PR PNKL FHHNVSL VS++VGTPPQ +MVLDTGSELSWLHC T S P Sbjct: 47 QEIPSGSFPRSPNKLPFHHNVSLAVSLTVGTPPQNVSMVLDTGSELSWLHCNNTRYSYPN 106 Query: 17 SFSPS 3 +F P+ Sbjct: 107 AFDPN 111 >ref|XP_006429126.1| hypothetical protein CICLE_v10011788mg [Citrus clementina] gi|557531183|gb|ESR42366.1| hypothetical protein CICLE_v10011788mg [Citrus clementina] Length = 428 Score = 91.3 bits (225), Expect = 1e-16 Identities = 44/65 (67%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -1 Query: 194 KQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTP-STPL 18 ++IPS S PR PNKL FHHNVSL VS++VGTPPQ +MVLDTGSELSWLHC T S P Sbjct: 47 QEIPSGSFPRSPNKLPFHHNVSLAVSLTVGTPPQNVSMVLDTGSELSWLHCNNTRYSYPN 106 Query: 17 SFSPS 3 +F P+ Sbjct: 107 AFDPN 111 >ref|XP_003530215.1| PREDICTED: aspartic proteinase PCS1-like [Glycine max] Length = 442 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = -1 Query: 188 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSF 12 IPS LPRPPNKL FHHNVSLT+S++VGTPPQ +MV+DTGSELSWLHC + + + Sbjct: 46 IPSGYLPRPPNKLRFHHNVSLTISITVGTPPQNMSMVIDTGSELSWLHCNTNTTATIPY 104 >ref|XP_002458751.1| hypothetical protein SORBIDRAFT_03g039590 [Sorghum bicolor] gi|241930726|gb|EES03871.1| hypothetical protein SORBIDRAFT_03g039590 [Sorghum bicolor] Length = 444 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -1 Query: 197 AKQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHC 42 A+Q+P+ +LPRPP+KL FHHNVSLTVS++VGTPPQ TMVLDTGSELSWL C Sbjct: 40 ARQVPAGALPRPPSKLRFHHNVSLTVSLAVGTPPQNVTMVLDTGSELSWLLC 91 >ref|XP_004970553.1| PREDICTED: aspartic proteinase PCS1-like [Setaria italica] Length = 441 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -1 Query: 197 AKQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHC 42 A+Q+P+ +LPRPP+KL FHHNVSLTVS++VGTPPQ TMVLDTGSELSWL C Sbjct: 40 ARQVPAWALPRPPSKLRFHHNVSLTVSLAVGTPPQNVTMVLDTGSELSWLLC 91 >ref|XP_002531560.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] gi|223528821|gb|EEF30826.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] Length = 407 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/57 (68%), Positives = 48/57 (84%) Frame = -1 Query: 194 KQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPST 24 ++IPS S PR PNKL F HN+SLTVS++VGTPPQ +MV+DTGSELSWL+C KT +T Sbjct: 9 EEIPSNSFPRSPNKLPFRHNISLTVSLTVGTPPQNVSMVIDTGSELSWLYCNKTTTT 65