BLASTX nr result
ID: Mentha28_contig00010196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00010196 (500 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45341.1| hypothetical protein MIMGU_mgv1a009902mg [Mimulus... 67 3e-09 gb|EPS67211.1| hypothetical protein M569_07557, partial [Genlise... 59 9e-07 gb|AGD98703.1| bZIP transcription factor family protein 5 [Camel... 56 5e-06 >gb|EYU45341.1| hypothetical protein MIMGU_mgv1a009902mg [Mimulus guttatus] Length = 328 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/45 (77%), Positives = 38/45 (84%), Gaps = 2/45 (4%) Frame = +1 Query: 370 MADGSPRTDTSTDADTEDK--MFQSIQLHGIGASDGSDKSRDQKT 498 MA+GSPRTDTSTDADTEDK FQ+ QL G+ ASDGSDK RDQKT Sbjct: 1 MAEGSPRTDTSTDADTEDKNMRFQNNQLQGMIASDGSDKPRDQKT 45 >gb|EPS67211.1| hypothetical protein M569_07557, partial [Genlisea aurea] Length = 324 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +1 Query: 382 SPRTDTSTDADTEDK--MFQSIQLHGIGASDGSDKSRDQKT 498 SPRTDTSTDADTEDK FQ+ QL ASDGSDKSRDQKT Sbjct: 1 SPRTDTSTDADTEDKNLRFQNNQLQVAVASDGSDKSRDQKT 41 >gb|AGD98703.1| bZIP transcription factor family protein 5 [Camellia sinensis] Length = 328 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/45 (68%), Positives = 32/45 (71%), Gaps = 2/45 (4%) Frame = +1 Query: 370 MADGSPRTDTSTDADTEDK--MFQSIQLHGIGASDGSDKSRDQKT 498 M D SPRTDTSTD DT+DK FQS Q I SD SDKSRDQKT Sbjct: 1 MEDISPRTDTSTDGDTDDKNLRFQSDQSQAIVTSDASDKSRDQKT 45