BLASTX nr result
ID: Mentha28_contig00008800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00008800 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532597.1| strictosidine synthase, putative [Ricinus co... 57 2e-06 >ref|XP_002532597.1| strictosidine synthase, putative [Ricinus communis] gi|223527685|gb|EEF29794.1| strictosidine synthase, putative [Ricinus communis] Length = 375 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/86 (36%), Positives = 49/86 (56%) Frame = -1 Query: 259 AITTKLIISTAFLLLSIAIFSISFDHNTAFDFENYNINQEFKNQTSLFGKINHKPMIMPM 80 A + +L+ +L +F+I+F T F ++ +NI + K+ + L ++P+ Sbjct: 2 ACSRQLLAGAILAVLVSTLFNINF---TNFSYKPFNIERLLKDDSEL---------LLPL 49 Query: 79 PGGAAGPESFAFDRLGGGPFTGVSDG 2 A GPESFAFD LG GP+TG+SDG Sbjct: 50 ARAATGPESFAFDGLGRGPYTGISDG 75