BLASTX nr result
ID: Mentha28_contig00008521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00008521 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006837141.1| hypothetical protein AMTR_s00110p00143020 [A... 57 3e-06 gb|EYU42126.1| hypothetical protein MIMGU_mgv1a009241mg [Mimulus... 56 6e-06 >ref|XP_006837141.1| hypothetical protein AMTR_s00110p00143020 [Amborella trichopoda] gi|548839734|gb|ERM99994.1| hypothetical protein AMTR_s00110p00143020 [Amborella trichopoda] Length = 318 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 7/47 (14%) Frame = +3 Query: 69 YHFWSSY-------VGPSLGAAVAIDFVVNHPEAVSVIFVIDPRAYS 188 Y FW SY VGPSLGAAVAIDF +NHPEAVS + +ID Y+ Sbjct: 122 YQFWKSYIKRPMVLVGPSLGAAVAIDFAINHPEAVSNLVLIDASVYA 168 >gb|EYU42126.1| hypothetical protein MIMGU_mgv1a009241mg [Mimulus guttatus] Length = 348 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 7/47 (14%) Frame = +3 Query: 69 YHFWSSY-------VGPSLGAAVAIDFVVNHPEAVSVIFVIDPRAYS 188 Y FW SY VGPSLGAAVAIDFVVN+PEAV + +ID Y+ Sbjct: 149 YQFWKSYIKRPMTLVGPSLGAAVAIDFVVNYPEAVDKLILIDASVYA 195