BLASTX nr result
ID: Mentha28_contig00008242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00008242 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006465838.1| PREDICTED: uncharacterized protein LOC102629... 84 2e-14 ref|XP_006426753.1| hypothetical protein CICLE_v10024713mg [Citr... 84 2e-14 ref|XP_006843854.1| hypothetical protein AMTR_s00007p00263470 [A... 84 3e-14 ref|XP_006598844.1| PREDICTED: dentin sialophosphoprotein-like i... 83 5e-14 ref|XP_007024717.1| Uncharacterized protein isoform 3 [Theobroma... 83 5e-14 ref|XP_007024715.1| Uncharacterized protein isoform 1 [Theobroma... 83 5e-14 ref|XP_006583175.1| PREDICTED: dentin sialophosphoprotein-like i... 82 8e-14 ref|XP_004510543.1| PREDICTED: serine-rich adhesin for platelets... 82 8e-14 ref|XP_004510542.1| PREDICTED: serine-rich adhesin for platelets... 82 8e-14 emb|CBI35826.3| unnamed protein product [Vitis vinifera] 82 8e-14 ref|XP_002271999.1| PREDICTED: uncharacterized protein LOC100251... 82 8e-14 ref|XP_003627371.1| COP1-interacting protein 7 (CIP7)-like prote... 82 8e-14 ref|XP_007135400.1| hypothetical protein PHAVU_010G126300g [Phas... 81 1e-13 ref|XP_006342942.1| PREDICTED: SAFB-like transcription modulator... 80 2e-13 ref|XP_004236381.1| PREDICTED: uncharacterized protein LOC101252... 80 2e-13 gb|EYU21289.1| hypothetical protein MIMGU_mgv1a000325mg [Mimulus... 78 1e-12 ref|XP_006369111.1| hypothetical protein POPTR_0001s16550g [Popu... 78 1e-12 ref|XP_007217656.1| hypothetical protein PRUPE_ppa000250mg [Prun... 78 1e-12 ref|XP_004141819.1| PREDICTED: uncharacterized protein LOC101213... 77 3e-12 ref|XP_006357423.1| PREDICTED: tetratricopeptide repeat protein ... 76 4e-12 >ref|XP_006465838.1| PREDICTED: uncharacterized protein LOC102629330 isoform X1 [Citrus sinensis] Length = 1419 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/44 (88%), Positives = 44/44 (100%) Frame = -1 Query: 461 SSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 SSIPAPPANFKLREDH++G+SIKAPRSFFSLSTFRSKG++SKPR Sbjct: 1376 SSIPAPPANFKLREDHMSGSSIKAPRSFFSLSTFRSKGSDSKPR 1419 >ref|XP_006426753.1| hypothetical protein CICLE_v10024713mg [Citrus clementina] gi|557528743|gb|ESR39993.1| hypothetical protein CICLE_v10024713mg [Citrus clementina] Length = 1409 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/44 (88%), Positives = 44/44 (100%) Frame = -1 Query: 461 SSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 SSIPAPPANFKLREDH++G+SIKAPRSFFSLSTFRSKG++SKPR Sbjct: 1366 SSIPAPPANFKLREDHMSGSSIKAPRSFFSLSTFRSKGSDSKPR 1409 >ref|XP_006843854.1| hypothetical protein AMTR_s00007p00263470 [Amborella trichopoda] gi|548846222|gb|ERN05529.1| hypothetical protein AMTR_s00007p00263470 [Amborella trichopoda] Length = 1529 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/45 (84%), Positives = 45/45 (100%) Frame = -1 Query: 464 QSSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 +SSIPAPPANFKLREDH++G+S+KAPRSFFSLS+FRSKG+ESKPR Sbjct: 1485 RSSIPAPPANFKLREDHLSGSSLKAPRSFFSLSSFRSKGSESKPR 1529 >ref|XP_006598844.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine max] Length = 1250 Score = 82.8 bits (203), Expect = 5e-14 Identities = 37/45 (82%), Positives = 45/45 (100%) Frame = -1 Query: 464 QSSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 QSSIPAPPA+FKLR+DH++G+SIKAP+SFFSLSTFRSKG++SKPR Sbjct: 1206 QSSIPAPPAHFKLRDDHISGSSIKAPKSFFSLSTFRSKGSDSKPR 1250 >ref|XP_007024717.1| Uncharacterized protein isoform 3 [Theobroma cacao] gi|508780083|gb|EOY27339.1| Uncharacterized protein isoform 3 [Theobroma cacao] Length = 1431 Score = 82.8 bits (203), Expect = 5e-14 Identities = 38/44 (86%), Positives = 44/44 (100%) Frame = -1 Query: 461 SSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 SSIPAPPANFKLREDH++G+SIKAPRSFFSLS+FRSKG++SKPR Sbjct: 1388 SSIPAPPANFKLREDHMSGSSIKAPRSFFSLSSFRSKGSDSKPR 1431 >ref|XP_007024715.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590621133|ref|XP_007024716.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508780081|gb|EOY27337.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508780082|gb|EOY27338.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 1428 Score = 82.8 bits (203), Expect = 5e-14 Identities = 38/44 (86%), Positives = 44/44 (100%) Frame = -1 Query: 461 SSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 SSIPAPPANFKLREDH++G+SIKAPRSFFSLS+FRSKG++SKPR Sbjct: 1385 SSIPAPPANFKLREDHMSGSSIKAPRSFFSLSSFRSKGSDSKPR 1428 >ref|XP_006583175.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine max] Length = 1250 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/45 (80%), Positives = 45/45 (100%) Frame = -1 Query: 464 QSSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 QSSIPAPPA+FKLR+DH++G+S+KAP+SFFSLSTFRSKG++SKPR Sbjct: 1206 QSSIPAPPAHFKLRDDHISGSSLKAPKSFFSLSTFRSKGSDSKPR 1250 >ref|XP_004510543.1| PREDICTED: serine-rich adhesin for platelets-like isoform X2 [Cicer arietinum] Length = 1245 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/45 (80%), Positives = 45/45 (100%) Frame = -1 Query: 464 QSSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 QSSIPAPPA+FKLR+DH++G+S+KAP+SFFSLSTFRSKG++SKPR Sbjct: 1201 QSSIPAPPAHFKLRDDHISGSSLKAPKSFFSLSTFRSKGSDSKPR 1245 >ref|XP_004510542.1| PREDICTED: serine-rich adhesin for platelets-like isoform X1 [Cicer arietinum] Length = 1252 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/45 (80%), Positives = 45/45 (100%) Frame = -1 Query: 464 QSSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 QSSIPAPPA+FKLR+DH++G+S+KAP+SFFSLSTFRSKG++SKPR Sbjct: 1208 QSSIPAPPAHFKLRDDHISGSSLKAPKSFFSLSTFRSKGSDSKPR 1252 >emb|CBI35826.3| unnamed protein product [Vitis vinifera] Length = 1163 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/44 (84%), Positives = 44/44 (100%) Frame = -1 Query: 461 SSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 SSIPAPPANFKLREDH++G+S+KAPRSFFSLS+FRSKG++SKPR Sbjct: 1120 SSIPAPPANFKLREDHLSGSSLKAPRSFFSLSSFRSKGSDSKPR 1163 >ref|XP_002271999.1| PREDICTED: uncharacterized protein LOC100251482 [Vitis vinifera] Length = 1409 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/44 (84%), Positives = 44/44 (100%) Frame = -1 Query: 461 SSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 SSIPAPPANFKLREDH++G+S+KAPRSFFSLS+FRSKG++SKPR Sbjct: 1366 SSIPAPPANFKLREDHLSGSSLKAPRSFFSLSSFRSKGSDSKPR 1409 >ref|XP_003627371.1| COP1-interacting protein 7 (CIP7)-like protein [Medicago truncatula] gi|355521393|gb|AET01847.1| COP1-interacting protein 7 (CIP7)-like protein [Medicago truncatula] Length = 1294 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/45 (80%), Positives = 45/45 (100%) Frame = -1 Query: 464 QSSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 QSSIPAPPA+FKLR+DH++G+S+KAP+SFFSLSTFRSKG++SKPR Sbjct: 1250 QSSIPAPPAHFKLRDDHISGSSLKAPKSFFSLSTFRSKGSDSKPR 1294 >ref|XP_007135400.1| hypothetical protein PHAVU_010G126300g [Phaseolus vulgaris] gi|561008445|gb|ESW07394.1| hypothetical protein PHAVU_010G126300g [Phaseolus vulgaris] Length = 1257 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/45 (80%), Positives = 45/45 (100%) Frame = -1 Query: 464 QSSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 QSSIPAPPA+FKLR+DH++G+S+KAP+SFFSLSTFRSKG++SKPR Sbjct: 1213 QSSIPAPPAHFKLRDDHMSGSSLKAPKSFFSLSTFRSKGSDSKPR 1257 >ref|XP_006342942.1| PREDICTED: SAFB-like transcription modulator-like [Solanum tuberosum] Length = 1342 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = -1 Query: 464 QSSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 +SSIPAPPANFKLRED ++G+SIKAPRSFFSLSTFRSKG++SKP+ Sbjct: 1298 RSSIPAPPANFKLREDQLSGSSIKAPRSFFSLSTFRSKGSDSKPK 1342 >ref|XP_004236381.1| PREDICTED: uncharacterized protein LOC101252575 [Solanum lycopersicum] Length = 1326 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = -1 Query: 464 QSSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 +SSIPAPPANFKLRED ++G+SIKAPRSFFSLSTFRSKG++SKP+ Sbjct: 1282 RSSIPAPPANFKLREDQLSGSSIKAPRSFFSLSTFRSKGSDSKPK 1326 >gb|EYU21289.1| hypothetical protein MIMGU_mgv1a000325mg [Mimulus guttatus] Length = 1255 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 461 SSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 SSIPAPP +F+LR+DHV+GTSIKAPRSFFSLSTFRSKG+ESK R Sbjct: 1212 SSIPAPPPDFELRDDHVSGTSIKAPRSFFSLSTFRSKGSESKLR 1255 >ref|XP_006369111.1| hypothetical protein POPTR_0001s16550g [Populus trichocarpa] gi|550347470|gb|ERP65680.1| hypothetical protein POPTR_0001s16550g [Populus trichocarpa] Length = 1242 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/44 (81%), Positives = 43/44 (97%) Frame = -1 Query: 461 SSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 SSIPAPPANFKLR+DH++G+SIKAPRSFFSLS+FRSKG++SK R Sbjct: 1199 SSIPAPPANFKLRDDHLSGSSIKAPRSFFSLSSFRSKGSDSKLR 1242 >ref|XP_007217656.1| hypothetical protein PRUPE_ppa000250mg [Prunus persica] gi|462413806|gb|EMJ18855.1| hypothetical protein PRUPE_ppa000250mg [Prunus persica] Length = 1402 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -1 Query: 464 QSSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 +SSIPAPP NFKLREDH++G+S+KAPRSFFSLS+FRSKG+ESK R Sbjct: 1358 RSSIPAPPMNFKLREDHLSGSSLKAPRSFFSLSSFRSKGSESKLR 1402 >ref|XP_004141819.1| PREDICTED: uncharacterized protein LOC101213033 [Cucumis sativus] gi|449480667|ref|XP_004155962.1| PREDICTED: uncharacterized LOC101213033 [Cucumis sativus] Length = 1411 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 461 SSIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 SSIPAPPANFKLREDH++G+S+KAPRSFFSLSTFRSKG ++ R Sbjct: 1368 SSIPAPPANFKLREDHMSGSSLKAPRSFFSLSTFRSKGTDATSR 1411 >ref|XP_006357423.1| PREDICTED: tetratricopeptide repeat protein 14-like isoform X2 [Solanum tuberosum] Length = 666 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -1 Query: 458 SIPAPPANFKLREDHVTGTSIKAPRSFFSLSTFRSKGNESKPR 330 SIPAPPANFK RE+H++G+SIKAPRSFFSLS+FRSKG +SKPR Sbjct: 624 SIPAPPANFKPRENHLSGSSIKAPRSFFSLSSFRSKGKDSKPR 666