BLASTX nr result
ID: Mentha28_contig00006498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00006498 (580 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007033513.1| WRKY DNA-binding protein 70, putative isofor... 57 3e-06 ref|XP_007033512.1| WRKY DNA-binding protein 70, putative isofor... 57 3e-06 >ref|XP_007033513.1| WRKY DNA-binding protein 70, putative isoform 2, partial [Theobroma cacao] gi|508712542|gb|EOY04439.1| WRKY DNA-binding protein 70, putative isoform 2, partial [Theobroma cacao] Length = 204 Score = 57.4 bits (137), Expect = 3e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = -2 Query: 105 RRNAETVVKESPNMVEDGHAWRKYGQKVILNAKHP 1 R++ + ++SP +++DGHAWRKYGQKVILNAKHP Sbjct: 104 RKSEHSWTRDSPTLIDDGHAWRKYGQKVILNAKHP 138 >ref|XP_007033512.1| WRKY DNA-binding protein 70, putative isoform 1 [Theobroma cacao] gi|508712541|gb|EOY04438.1| WRKY DNA-binding protein 70, putative isoform 1 [Theobroma cacao] Length = 285 Score = 57.4 bits (137), Expect = 3e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = -2 Query: 105 RRNAETVVKESPNMVEDGHAWRKYGQKVILNAKHP 1 R++ + ++SP +++DGHAWRKYGQKVILNAKHP Sbjct: 104 RKSEHSWTRDSPTLIDDGHAWRKYGQKVILNAKHP 138