BLASTX nr result
ID: Mentha28_contig00006434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00006434 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60566.1| hypothetical protein M569_14237 [Genlisea aurea] 70 3e-10 gb|EYU35509.1| hypothetical protein MIMGU_mgv1a010814mg [Mimulus... 66 4e-09 >gb|EPS60566.1| hypothetical protein M569_14237 [Genlisea aurea] Length = 307 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +2 Query: 2 AICTEKHGALDGKRNAPGKLLVWKTIPFLEDEYVSGTYAVKTICGYS 142 AICTEK+ LDGK+ A KL VW+TIP++EDEYVSGT AV+ ICG++ Sbjct: 261 AICTEKYCGLDGKQKALAKLKVWRTIPYVEDEYVSGTDAVRVICGFT 307 >gb|EYU35509.1| hypothetical protein MIMGU_mgv1a010814mg [Mimulus guttatus] Length = 301 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/46 (73%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +2 Query: 2 AICTEKHGA-LDGKRNAPGKLLVWKTIPFLEDEYVSGTYAVKTICG 136 AICTEKH A +GKRN P KL VWKTIPF+ DE VSGT AVKTI G Sbjct: 256 AICTEKHAASAEGKRNVPTKLTVWKTIPFVVDECVSGTDAVKTIYG 301