BLASTX nr result
ID: Mentha28_contig00006135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00006135 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC24899.1| Cyclin-dependent kinases regulatory subunit 2 [Mo... 106 4e-21 ref|XP_004985721.1| PREDICTED: cyclin-dependent kinases regulato... 106 4e-21 ref|XP_007016049.1| Cyclin-dependent kinases regulatory subunit ... 106 4e-21 ref|XP_004506113.1| PREDICTED: cyclin-dependent kinases regulato... 106 4e-21 ref|XP_006295329.1| hypothetical protein CARUB_v10024417mg [Caps... 106 4e-21 ref|XP_007207527.1| hypothetical protein PRUPE_ppa014100mg [Prun... 106 4e-21 ref|XP_004171476.1| PREDICTED: cyclin-dependent kinases regulato... 106 4e-21 gb|AFK45733.1| unknown [Lotus japonicus] 106 4e-21 ref|XP_003606312.1| Cyclin-dependent kinases regulatory subunit ... 106 4e-21 ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyr... 106 4e-21 ref|XP_002523737.1| Cyclin-dependent kinases regulatory subunit,... 106 4e-21 gb|ABE01245.1| cyclin-dependent kinases regulatory subunit [Came... 106 4e-21 dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] 106 4e-21 gb|AAS79576.1| putative CDK regulatory subunit [Ipomoea trifida] 106 4e-21 ref|NP_001237104.1| cyclin-dependent kinases regulatory subunit ... 106 4e-21 ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [... 105 5e-21 ref|NP_001147261.1| cyclin-dependent kinases regulatory subunit ... 105 7e-21 gb|EPS59959.1| hypothetical protein M569_14849, partial [Genlise... 105 9e-21 ref|XP_004294559.1| PREDICTED: cyclin-dependent kinases regulato... 105 9e-21 ref|XP_004250987.1| PREDICTED: cyclin-dependent kinases regulato... 105 9e-21 >gb|EXC24899.1| Cyclin-dependent kinases regulatory subunit 2 [Morus notabilis] Length = 82 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_004985721.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Setaria italica] Length = 90 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_007016049.1| Cyclin-dependent kinases regulatory subunit 1 [Theobroma cacao] gi|508786412|gb|EOY33668.1| Cyclin-dependent kinases regulatory subunit 1 [Theobroma cacao] Length = 88 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_004506113.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Cicer arietinum] Length = 88 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_006295329.1| hypothetical protein CARUB_v10024417mg [Capsella rubella] gi|482564037|gb|EOA28227.1| hypothetical protein CARUB_v10024417mg [Capsella rubella] Length = 87 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_007207527.1| hypothetical protein PRUPE_ppa014100mg [Prunus persica] gi|462403169|gb|EMJ08726.1| hypothetical protein PRUPE_ppa014100mg [Prunus persica] Length = 87 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_004171476.1| PREDICTED: cyclin-dependent kinases regulatory subunit 2-like [Cucumis sativus] Length = 88 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >gb|AFK45733.1| unknown [Lotus japonicus] Length = 88 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_003606312.1| Cyclin-dependent kinases regulatory subunit [Medicago truncatula] gi|355507367|gb|AES88509.1| Cyclin-dependent kinases regulatory subunit [Medicago truncatula] gi|388496380|gb|AFK36256.1| unknown [Medicago truncatula] Length = 88 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] gi|297324964|gb|EFH55384.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] Length = 87 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_002523737.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] gi|223537041|gb|EEF38677.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] Length = 88 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >gb|ABE01245.1| cyclin-dependent kinases regulatory subunit [Camellia sinensis] Length = 88 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] Length = 1291 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 1228 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 1276 >gb|AAS79576.1| putative CDK regulatory subunit [Ipomoea trifida] Length = 88 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|NP_001237104.1| cyclin-dependent kinases regulatory subunit [Glycine max] gi|356542684|ref|XP_003539796.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Glycine max] gi|571486483|ref|XP_006590361.1| PREDICTED: cyclin-dependent kinases regulatory subunit isoform X1 [Glycine max] gi|593196857|ref|XP_007132345.1| hypothetical protein PHAVU_011G086900g [Phaseolus vulgaris] gi|42362268|gb|AAS13367.1| cyclin-dependent kinases regulatory subunit [Glycine max] gi|255628843|gb|ACU14766.1| unknown [Glycine max] gi|388501782|gb|AFK38957.1| unknown [Lotus japonicus] gi|561005345|gb|ESW04339.1| hypothetical protein PHAVU_011G086900g [Phaseolus vulgaris] Length = 88 Score = 106 bits (264), Expect = 4e-21 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] gi|75097781|sp|O23249.1|CKS1_ARATH RecName: Full=Cyclin-dependent kinases regulatory subunit 1; AltName: Full=CKS1-At gi|2274859|emb|CAA03859.1| Cks1 protein [Arabidopsis thaliana] gi|4510420|gb|AAD21506.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|21593913|gb|AAM65878.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969580|dbj|BAD43482.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969798|dbj|BAD43591.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51970380|dbj|BAD43882.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|88010880|gb|ABD38867.1| At2g27960 [Arabidopsis thaliana] gi|330252970|gb|AEC08064.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] Length = 87 Score = 105 bits (263), Expect = 5e-21 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYA+HRPEPHIMLFRRPLNY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAVHRPEPHIMLFRRPLNY 73 >ref|NP_001147261.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|194702034|gb|ACF85101.1| unknown [Zea mays] gi|195604506|gb|ACG24083.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195606852|gb|ACG25256.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608282|gb|ACG25971.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608534|gb|ACG26097.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608568|gb|ACG26114.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608768|gb|ACG26214.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608806|gb|ACG26233.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195608824|gb|ACG26242.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195609230|gb|ACG26445.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195609378|gb|ACG26519.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195609486|gb|ACG26573.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195610092|gb|ACG26876.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195610384|gb|ACG27022.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195610444|gb|ACG27052.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195610678|gb|ACG27169.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195617154|gb|ACG30407.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195617600|gb|ACG30630.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|195639798|gb|ACG39367.1| cyclin-dependent kinases regulatory subunit [Zea mays] gi|413957008|gb|AFW89657.1| hypothetical protein ZEAMMB73_443898 [Zea mays] Length = 87 Score = 105 bits (262), Expect = 7e-21 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRP+NY Sbjct: 25 EVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPINY 73 >gb|EPS59959.1| hypothetical protein M569_14849, partial [Genlisea aurea] Length = 76 Score = 105 bits (261), Expect = 9e-21 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EVAKLLPKNRLL+ENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 15 EVAKLLPKNRLLAENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 63 >ref|XP_004294559.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Fragaria vesca subsp. vesca] Length = 85 Score = 105 bits (261), Expect = 9e-21 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 EV+KLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 EVSKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_004250987.1| PREDICTED: cyclin-dependent kinases regulatory subunit 2-like [Solanum lycopersicum] gi|565364675|ref|XP_006349044.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Solanum tuberosum] Length = 88 Score = 105 bits (261), Expect = 9e-21 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +1 Query: 4 EVAKLLPKNRLLSENEWRAMGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 150 +VAKLLPKNRLLSENEWRA+GVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 25 DVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73