BLASTX nr result
ID: Mentha28_contig00006012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00006012 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46327.1| hypothetical protein MIMGU_mgv1a000070mg [Mimulus... 78 1e-12 ref|XP_006399785.1| hypothetical protein EUTSA_v10012412mg [Eutr... 78 1e-12 ref|XP_002304888.2| GLUCAN SYNTHASE-LIKE 9 family protein [Popul... 78 1e-12 gb|ADM72799.1| callose synthase 3 [Arabidopsis thaliana] 78 1e-12 ref|NP_001154712.2| callose synthase 3 [Arabidopsis thaliana] gi... 78 1e-12 ref|NP_196804.6| callose synthase 3 [Arabidopsis thaliana] gi|35... 78 1e-12 ref|XP_002873593.1| hypothetical protein ARALYDRAFT_325786 [Arab... 78 1e-12 ref|XP_002283298.2| PREDICTED: callose synthase 3-like [Vitis vi... 78 1e-12 emb|CAB88264.1| callose synthase catalytic subunit-like protein ... 78 1e-12 ref|XP_004149021.1| PREDICTED: LOW QUALITY PROTEIN: callose synt... 77 3e-12 gb|EYU17999.1| hypothetical protein MIMGU_mgv1a000067mg [Mimulus... 76 4e-12 gb|EPS70715.1| hypothetical protein M569_04038, partial [Genlise... 76 4e-12 ref|XP_006657366.1| PREDICTED: callose synthase 3-like [Oryza br... 76 6e-12 dbj|BAD62105.1| putative callose synthase 1 catalytic subunit [O... 76 6e-12 gb|EEE66395.1| hypothetical protein OsJ_22734 [Oryza sativa Japo... 76 6e-12 gb|EEC81348.1| hypothetical protein OsI_24536 [Oryza sativa Indi... 76 6e-12 gb|EXB29008.1| Callose synthase 3 [Morus notabilis] 75 1e-11 ref|XP_006445915.1| hypothetical protein CICLE_v10014015mg [Citr... 75 1e-11 ref|XP_007208314.1| hypothetical protein PRUPE_ppa003008mg [Prun... 75 1e-11 ref|XP_006648179.1| PREDICTED: callose synthase 3-like [Oryza br... 75 1e-11 >gb|EYU46327.1| hypothetical protein MIMGU_mgv1a000070mg [Mimulus guttatus] Length = 1935 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE Sbjct: 1898 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1935 >ref|XP_006399785.1| hypothetical protein EUTSA_v10012412mg [Eutrema salsugineum] gi|557100875|gb|ESQ41238.1| hypothetical protein EUTSA_v10012412mg [Eutrema salsugineum] Length = 1954 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE Sbjct: 1917 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1954 >ref|XP_002304888.2| GLUCAN SYNTHASE-LIKE 9 family protein [Populus trichocarpa] gi|550343723|gb|EEE79867.2| GLUCAN SYNTHASE-LIKE 9 family protein [Populus trichocarpa] Length = 1852 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE Sbjct: 1815 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1852 >gb|ADM72799.1| callose synthase 3 [Arabidopsis thaliana] Length = 1947 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE Sbjct: 1910 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1947 >ref|NP_001154712.2| callose synthase 3 [Arabidopsis thaliana] gi|332004457|gb|AED91840.1| callose synthase 3 [Arabidopsis thaliana] Length = 1914 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE Sbjct: 1877 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1914 >ref|NP_196804.6| callose synthase 3 [Arabidopsis thaliana] gi|357529555|sp|Q9LXT9.3|CALS3_ARATH RecName: Full=Callose synthase 3; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 12 gi|332004456|gb|AED91839.1| callose synthase 3 [Arabidopsis thaliana] Length = 1955 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE Sbjct: 1918 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1955 >ref|XP_002873593.1| hypothetical protein ARALYDRAFT_325786 [Arabidopsis lyrata subsp. lyrata] gi|297319430|gb|EFH49852.1| hypothetical protein ARALYDRAFT_325786 [Arabidopsis lyrata subsp. lyrata] Length = 1902 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE Sbjct: 1865 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1902 >ref|XP_002283298.2| PREDICTED: callose synthase 3-like [Vitis vinifera] gi|297746400|emb|CBI16456.3| unnamed protein product [Vitis vinifera] Length = 1948 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE Sbjct: 1911 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1948 >emb|CAB88264.1| callose synthase catalytic subunit-like protein [Arabidopsis thaliana] Length = 1963 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE Sbjct: 1926 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1963 >ref|XP_004149021.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 3-like [Cucumis sativus] Length = 1959 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNK+ Sbjct: 1922 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKD 1959 >gb|EYU17999.1| hypothetical protein MIMGU_mgv1a000067mg [Mimulus guttatus] Length = 1948 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSR+KE Sbjct: 1911 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRSKE 1948 >gb|EPS70715.1| hypothetical protein M569_04038, partial [Genlisea aurea] Length = 1941 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSR+KE Sbjct: 1904 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRSKE 1941 >ref|XP_006657366.1| PREDICTED: callose synthase 3-like [Oryza brachyantha] Length = 1958 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGH+KDRS+RNKE Sbjct: 1921 FVSEFQTRMLFNQAFSRGLQISRILGGHKKDRSTRNKE 1958 >dbj|BAD62105.1| putative callose synthase 1 catalytic subunit [Oryza sativa Japonica Group] Length = 1959 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGH+KDRS+RNKE Sbjct: 1922 FVSEFQTRMLFNQAFSRGLQISRILGGHKKDRSTRNKE 1959 >gb|EEE66395.1| hypothetical protein OsJ_22734 [Oryza sativa Japonica Group] Length = 1982 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGH+KDRS+RNKE Sbjct: 1945 FVSEFQTRMLFNQAFSRGLQISRILGGHKKDRSTRNKE 1982 >gb|EEC81348.1| hypothetical protein OsI_24536 [Oryza sativa Indica Group] Length = 1724 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGH+KDRS+RNKE Sbjct: 1687 FVSEFQTRMLFNQAFSRGLQISRILGGHKKDRSTRNKE 1724 >gb|EXB29008.1| Callose synthase 3 [Morus notabilis] Length = 1951 Score = 75.1 bits (183), Expect = 1e-11 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGG RKDRSSRNKE Sbjct: 1914 FVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1951 >ref|XP_006445915.1| hypothetical protein CICLE_v10014015mg [Citrus clementina] gi|568879436|ref|XP_006492664.1| PREDICTED: callose synthase 3-like [Citrus sinensis] gi|557548526|gb|ESR59155.1| hypothetical protein CICLE_v10014015mg [Citrus clementina] Length = 1946 Score = 75.1 bits (183), Expect = 1e-11 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGG RKDRSSRNKE Sbjct: 1909 FVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1946 >ref|XP_007208314.1| hypothetical protein PRUPE_ppa003008mg [Prunus persica] gi|462403956|gb|EMJ09513.1| hypothetical protein PRUPE_ppa003008mg [Prunus persica] Length = 612 Score = 75.1 bits (183), Expect = 1e-11 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGG RKDRSSRNKE Sbjct: 575 FVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 612 >ref|XP_006648179.1| PREDICTED: callose synthase 3-like [Oryza brachyantha] Length = 1952 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 324 FVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 211 FVSEFQTRMLFNQAFSRGLQISRILGGH+KDR++RNKE Sbjct: 1915 FVSEFQTRMLFNQAFSRGLQISRILGGHKKDRAARNKE 1952