BLASTX nr result
ID: Mentha28_contig00004489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00004489 (599 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006337992.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 56 7e-06 >ref|XP_006337992.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Solanum tuberosum] Length = 1030 Score = 56.2 bits (134), Expect = 7e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 438 EIVDHLLYQNPGSDPVHGQHLQCFHFLGTILAK 340 E DHLLY NPGS VH QHLQ FHFLGT+LAK Sbjct: 739 ETADHLLYPNPGSGMVHDQHLQYFHFLGTVLAK 771