BLASTX nr result
ID: Mentha28_contig00003950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00003950 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43698.1| hypothetical protein MIMGU_mgv1a000899mg [Mimulus... 80 2e-13 ref|XP_004145484.1| PREDICTED: putative E3 ubiquitin-protein lig... 59 7e-07 ref|XP_004233209.1| PREDICTED: putative E3 ubiquitin-protein lig... 57 3e-06 >gb|EYU43698.1| hypothetical protein MIMGU_mgv1a000899mg [Mimulus guttatus] Length = 947 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/57 (71%), Positives = 44/57 (77%) Frame = +1 Query: 142 MASLHKLLSQDGFHPENSPKPTKKVKFRDRKNQQDSITLPIYICHDRRSFDSSKPRP 312 MASLHKLLSQ+GF S KP KKVKF+D N SITLPIYICHDRRSFDSS +P Sbjct: 1 MASLHKLLSQEGFERRISRKPNKKVKFKDDSN---SITLPIYICHDRRSFDSSSSKP 54 >ref|XP_004145484.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Cucumis sativus] gi|449527759|ref|XP_004170877.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Cucumis sativus] Length = 863 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 2/58 (3%) Frame = +1 Query: 142 MASLHKLLSQDGFHPENSPKPTK--KVKFRDRKNQQDSITLPIYICHDRRSFDSSKPR 309 MASL +LL+++GF N P K + K R R DS+TLPIYICHD+++ DSSK + Sbjct: 1 MASLQELLTREGFEGSNYPSTRKLSRPKGRSRTAPDDSVTLPIYICHDKKTIDSSKKK 58 >ref|XP_004233209.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Solanum lycopersicum] Length = 1002 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/62 (51%), Positives = 43/62 (69%), Gaps = 4/62 (6%) Frame = +1 Query: 142 MASLHKLLSQDGFHPENSPKPTKKVKFRDRKNQQDSITLPIYICHDRRS----FDSSKPR 309 MASL +LL+ +GF E + K +KVKF+DR++ ++I LPIYICHDRRS F +K R Sbjct: 1 MASLQELLADEGF--EKTKKTHRKVKFKDREDS-NNIALPIYICHDRRSSSLDFSKTKSR 57 Query: 310 PP 315 P Sbjct: 58 RP 59