BLASTX nr result
ID: Mentha28_contig00003853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00003853 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277136.1| PREDICTED: dedicator of cytokinesis protein ... 58 4e-08 ref|XP_004306572.1| PREDICTED: LOW QUALITY PROTEIN: dedicator of... 58 4e-08 gb|EPS68174.1| hypothetical protein M569_06596, partial [Genlise... 57 5e-08 gb|EYU31222.1| hypothetical protein MIMGU_mgv1a000090mg [Mimulus... 58 7e-08 ref|XP_003628402.1| Dedicator of cytokinesis [Medicago truncatul... 58 9e-08 ref|XP_004511179.1| PREDICTED: dedicator of cytokinesis protein ... 58 9e-08 ref|XP_004244792.1| PREDICTED: dedicator of cytokinesis protein ... 57 1e-07 ref|XP_006364260.1| PREDICTED: dedicator of cytokinesis protein ... 57 1e-07 ref|XP_003545706.1| PREDICTED: dedicator of cytokinesis protein ... 58 1e-07 ref|XP_006597990.1| PREDICTED: dedicator of cytokinesis protein ... 58 1e-07 gb|EXB56748.1| Dedicator of cytokinesis protein 6 [Morus notabilis] 56 2e-07 ref|XP_004139836.1| PREDICTED: dedicator of cytokinesis protein ... 58 2e-07 ref|XP_004159183.1| PREDICTED: LOW QUALITY PROTEIN: dedicator of... 58 2e-07 ref|XP_004984509.1| PREDICTED: dedicator of cytokinesis protein ... 57 2e-07 gb|AAN65000.1| Putative adapter protein SPIKE1 [Oryza sativa Jap... 57 2e-07 gb|AFW88481.1| hypothetical protein ZEAMMB73_738687 [Zea mays] 57 2e-07 gb|EEE59237.1| hypothetical protein OsJ_11229 [Oryza sativa Japo... 57 2e-07 ref|XP_004984511.1| PREDICTED: dedicator of cytokinesis protein ... 57 2e-07 ref|XP_004984510.1| PREDICTED: dedicator of cytokinesis protein ... 57 2e-07 ref|XP_006650023.1| PREDICTED: dedicator of cytokinesis protein ... 57 2e-07 >ref|XP_002277136.1| PREDICTED: dedicator of cytokinesis protein 11 [Vitis vinifera] gi|297738489|emb|CBI27734.3| unnamed protein product [Vitis vinifera] Length = 1847 Score = 57.8 bits (138), Expect(3) = 4e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISSGDLSQL 231 LQI+CDHDLFVEMPGRDPSDRNY+SS + +L Sbjct: 900 LQIICDHDLFVEMPGRDPSDRNYLSSVLIQEL 931 Score = 23.1 bits (48), Expect(3) = 4e-08 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV*ETAKCIENQDS 151 F +H+DLS RAK + + C DS Sbjct: 932 FLTWDHDDLSQRAKAARILVVLLCKHEFDS 961 Score = 21.2 bits (43), Expect(3) = 4e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 893 HDCKLTF 899 >ref|XP_004306572.1| PREDICTED: LOW QUALITY PROTEIN: dedicator of cytokinesis protein 7-like [Fragaria vesca subsp. vesca] Length = 1845 Score = 57.8 bits (138), Expect(3) = 4e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISSGDLSQL 231 LQI+CDHDLFVEMPGRDPSDRNY+SS + +L Sbjct: 898 LQIICDHDLFVEMPGRDPSDRNYLSSVLIQEL 929 Score = 23.1 bits (48), Expect(3) = 4e-08 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV*ETAKCIENQDS 151 F +H+DLS+RAK + V C D+ Sbjct: 930 FLTWDHDDLSLRAKAARVLVVLLCKHEFDA 959 Score = 21.2 bits (43), Expect(3) = 4e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 891 HDCKLTF 897 >gb|EPS68174.1| hypothetical protein M569_06596, partial [Genlisea aurea] Length = 1823 Score = 56.6 bits (135), Expect(3) = 5e-08 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 L+ILCDHDLFVEMPGRDPSDRNY+SS Sbjct: 873 LRILCDHDLFVEMPGRDPSDRNYLSS 898 Score = 22.7 bits (47), Expect(3) = 5e-08 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 346 HDCKLTFCR 320 HDCKLTF R Sbjct: 866 HDCKLTFLR 874 Score = 22.3 bits (46), Expect(3) = 5e-08 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVS 193 F +HEDLSMR K + Sbjct: 905 FLTWDHEDLSMRVKAA 920 >gb|EYU31222.1| hypothetical protein MIMGU_mgv1a000090mg [Mimulus guttatus] Length = 1845 Score = 58.2 bits (139), Expect(2) = 7e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 LQILCDHDLFVEMPGRDPSDRNY+SS Sbjct: 899 LQILCDHDLFVEMPGRDPSDRNYLSS 924 Score = 23.9 bits (50), Expect(2) = 7e-08 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVS 193 F +HEDLSMRAK + Sbjct: 931 FLTWDHEDLSMRAKAA 946 >ref|XP_003628402.1| Dedicator of cytokinesis [Medicago truncatula] gi|355522424|gb|AET02878.1| Dedicator of cytokinesis [Medicago truncatula] Length = 2136 Score = 57.8 bits (138), Expect(2) = 9e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISSGDLSQL 231 LQI+CDHDLFVEMPGRDPSDRNY+SS + +L Sbjct: 1095 LQIICDHDLFVEMPGRDPSDRNYLSSVLIQEL 1126 Score = 23.9 bits (50), Expect(2) = 9e-08 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 8/46 (17%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV*ETAKCIEN--------QDSISVCILYL 127 F +HEDLS+RAK + + C +D + + LYL Sbjct: 1127 FVTWDHEDLSLRAKAARILVVLLCKHEFDVRYQKPEDKLYIAQLYL 1172 >ref|XP_004511179.1| PREDICTED: dedicator of cytokinesis protein 6-like [Cicer arietinum] Length = 1836 Score = 57.8 bits (138), Expect(2) = 9e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISSGDLSQL 231 LQI+CDHDLFVEMPGRDPSDRNY+SS + +L Sbjct: 889 LQIICDHDLFVEMPGRDPSDRNYLSSVLIQEL 920 Score = 23.9 bits (50), Expect(2) = 9e-08 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 8/46 (17%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV*ETAKCIEN--------QDSISVCILYL 127 F +HEDLS+RAK + + C +D + + LYL Sbjct: 921 FVTWDHEDLSLRAKAARILVVLLCKHEFDVRYQKPEDKLYIAQLYL 966 >ref|XP_004244792.1| PREDICTED: dedicator of cytokinesis protein 10-like [Solanum lycopersicum] Length = 1845 Score = 57.4 bits (137), Expect(2) = 1e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 LQI+CDHDLFVEMPGRDPSDRNY+SS Sbjct: 892 LQIICDHDLFVEMPGRDPSDRNYLSS 917 Score = 23.9 bits (50), Expect(2) = 1e-07 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV*ETAKC 169 F +H+DLSMRAK + + C Sbjct: 924 FLTWDHDDLSMRAKAARILVVLMC 947 >ref|XP_006364260.1| PREDICTED: dedicator of cytokinesis protein 7-like [Solanum tuberosum] Length = 1836 Score = 57.4 bits (137), Expect(2) = 1e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 LQI+CDHDLFVEMPGRDPSDRNY+SS Sbjct: 892 LQIICDHDLFVEMPGRDPSDRNYLSS 917 Score = 23.9 bits (50), Expect(2) = 1e-07 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV*ETAKC 169 F +H+DLSMRAK + + C Sbjct: 924 FLTWDHDDLSMRAKAARILVVLMC 947 >ref|XP_003545706.1| PREDICTED: dedicator of cytokinesis protein 7-like isoform X1 [Glycine max] Length = 1835 Score = 57.8 bits (138), Expect(2) = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISSGDLSQL 231 LQI+CDHDLFVEMPGRDPSDRNY+SS + +L Sbjct: 888 LQIICDHDLFVEMPGRDPSDRNYLSSVLIQEL 919 Score = 23.5 bits (49), Expect(2) = 1e-07 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV 187 F +HEDLS+RAK + + Sbjct: 920 FVTWDHEDLSLRAKAARI 937 >ref|XP_006597990.1| PREDICTED: dedicator of cytokinesis protein 7-like isoform X2 [Glycine max] Length = 1510 Score = 57.8 bits (138), Expect(2) = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISSGDLSQL 231 LQI+CDHDLFVEMPGRDPSDRNY+SS + +L Sbjct: 888 LQIICDHDLFVEMPGRDPSDRNYLSSVLIQEL 919 Score = 23.5 bits (49), Expect(2) = 1e-07 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV 187 F +HEDLS+RAK + + Sbjct: 920 FVTWDHEDLSLRAKAARI 937 >gb|EXB56748.1| Dedicator of cytokinesis protein 6 [Morus notabilis] Length = 1982 Score = 55.8 bits (133), Expect(3) = 2e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISSGDLSQL 231 L I+CDHDLFVEMPGRDPSDRNY+SS + +L Sbjct: 885 LHIICDHDLFVEMPGRDPSDRNYLSSVLIQEL 916 Score = 22.7 bits (47), Expect(3) = 2e-07 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV*ETAKCIENQDS 151 F +H+DLS+RAK + + C D+ Sbjct: 917 FLTWDHDDLSLRAKAARILVVLLCKHEFDA 946 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 878 HDCKLTF 884 >ref|XP_004139836.1| PREDICTED: dedicator of cytokinesis protein 11-like [Cucumis sativus] Length = 1838 Score = 57.8 bits (138), Expect(3) = 2e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISSGDLSQL 231 LQI+CDHDLFVEMPGRDPSDRNY+SS + +L Sbjct: 889 LQIICDHDLFVEMPGRDPSDRNYLSSVLIQEL 920 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 882 HDCKLTF 888 Score = 20.8 bits (42), Expect(3) = 2e-07 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV*ETAKCIENQDS 151 F +H+DL +RAK + + C D+ Sbjct: 921 FLTWDHDDLPLRAKAARILVVLLCKHEFDA 950 >ref|XP_004159183.1| PREDICTED: LOW QUALITY PROTEIN: dedicator of cytokinesis protein 11-like [Cucumis sativus] Length = 1833 Score = 57.8 bits (138), Expect(3) = 2e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISSGDLSQL 231 LQI+CDHDLFVEMPGRDPSDRNY+SS + +L Sbjct: 884 LQIICDHDLFVEMPGRDPSDRNYLSSVLIQEL 915 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 877 HDCKLTF 883 Score = 20.8 bits (42), Expect(3) = 2e-07 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 240 FSAGNHEDLSMRAKVSAV*ETAKCIENQDS 151 F +H+DL +RAK + + C D+ Sbjct: 916 FLTWDHDDLPLRAKAARILVVLLCKHEFDA 945 >ref|XP_004984509.1| PREDICTED: dedicator of cytokinesis protein 7-like isoform X1 [Setaria italica] Length = 1912 Score = 57.4 bits (137), Expect(3) = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 LQI+CDHDLFVEMPGRDPSDRNY+SS Sbjct: 966 LQIICDHDLFVEMPGRDPSDRNYLSS 991 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 959 HDCKLTF 965 Score = 20.8 bits (42), Expect(3) = 2e-07 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 228 NHEDLSMRAKVSAV 187 +H+DLS RAK + + Sbjct: 1002 DHDDLSQRAKAARI 1015 >gb|AAN65000.1| Putative adapter protein SPIKE1 [Oryza sativa Japonica Group] Length = 1852 Score = 57.4 bits (137), Expect(3) = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 LQI+CDHDLFVEMPGRDPSDRNY+SS Sbjct: 898 LQIICDHDLFVEMPGRDPSDRNYLSS 923 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 891 HDCKLTF 897 Score = 20.8 bits (42), Expect(3) = 2e-07 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 228 NHEDLSMRAKVSAV 187 +H+DLS RAK + + Sbjct: 934 DHDDLSQRAKAARI 947 >gb|AFW88481.1| hypothetical protein ZEAMMB73_738687 [Zea mays] Length = 1848 Score = 57.4 bits (137), Expect(3) = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 LQI+CDHDLFVEMPGRDPSDRNY+SS Sbjct: 902 LQIICDHDLFVEMPGRDPSDRNYLSS 927 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 895 HDCKLTF 901 Score = 20.8 bits (42), Expect(3) = 2e-07 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 228 NHEDLSMRAKVSAV 187 +H+DLS RAK + + Sbjct: 938 DHDDLSQRAKAARI 951 >gb|EEE59237.1| hypothetical protein OsJ_11229 [Oryza sativa Japonica Group] Length = 1843 Score = 57.4 bits (137), Expect(3) = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 LQI+CDHDLFVEMPGRDPSDRNY+SS Sbjct: 889 LQIICDHDLFVEMPGRDPSDRNYLSS 914 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 882 HDCKLTF 888 Score = 20.8 bits (42), Expect(3) = 2e-07 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 228 NHEDLSMRAKVSAV 187 +H+DLS RAK + + Sbjct: 925 DHDDLSQRAKAARI 938 >ref|XP_004984511.1| PREDICTED: dedicator of cytokinesis protein 7-like isoform X3 [Setaria italica] Length = 1839 Score = 57.4 bits (137), Expect(3) = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 LQI+CDHDLFVEMPGRDPSDRNY+SS Sbjct: 893 LQIICDHDLFVEMPGRDPSDRNYLSS 918 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 886 HDCKLTF 892 Score = 20.8 bits (42), Expect(3) = 2e-07 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 228 NHEDLSMRAKVSAV 187 +H+DLS RAK + + Sbjct: 929 DHDDLSQRAKAARI 942 >ref|XP_004984510.1| PREDICTED: dedicator of cytokinesis protein 7-like isoform X2 [Setaria italica] Length = 1836 Score = 57.4 bits (137), Expect(3) = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 LQI+CDHDLFVEMPGRDPSDRNY+SS Sbjct: 890 LQIICDHDLFVEMPGRDPSDRNYLSS 915 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 883 HDCKLTF 889 Score = 20.8 bits (42), Expect(3) = 2e-07 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 228 NHEDLSMRAKVSAV 187 +H+DLS RAK + + Sbjct: 926 DHDDLSQRAKAARI 939 >ref|XP_006650023.1| PREDICTED: dedicator of cytokinesis protein 7-like [Oryza brachyantha] Length = 1835 Score = 57.4 bits (137), Expect(3) = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 326 LQILCDHDLFVEMPGRDPSDRNYISS 249 LQI+CDHDLFVEMPGRDPSDRNY+SS Sbjct: 889 LQIICDHDLFVEMPGRDPSDRNYLSS 914 Score = 21.2 bits (43), Expect(3) = 2e-07 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 346 HDCKLTF 326 HDCKLTF Sbjct: 882 HDCKLTF 888 Score = 20.8 bits (42), Expect(3) = 2e-07 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 228 NHEDLSMRAKVSAV 187 +H+DLS RAK + + Sbjct: 925 DHDDLSQRAKAARI 938