BLASTX nr result
ID: Mentha28_contig00001833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00001833 (655 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36415.1| hypothetical protein MIMGU_mgv1a009474mg [Mimulus... 60 8e-07 >gb|EYU36415.1| hypothetical protein MIMGU_mgv1a009474mg [Mimulus guttatus] Length = 340 Score = 59.7 bits (143), Expect = 8e-07 Identities = 39/66 (59%), Positives = 45/66 (68%), Gaps = 2/66 (3%) Frame = -1 Query: 193 MGGEIAYCXXXXXXXEVTKDRELEEEKMVAQMRYSA--IGGGFSPAPTMNVVVVGYALTS 20 M GEIAY E K+ E+EE+ M AQ +Y+A +GGGF PA M VVVVGYALTS Sbjct: 1 MIGEIAY------RKEEEKEEEVEEKMMSAQRKYTAAMVGGGFPPA--MKVVVVGYALTS 52 Query: 19 KKIKSF 2 KKIKSF Sbjct: 53 KKIKSF 58