BLASTX nr result
ID: Mentha28_contig00001624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00001624 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35639.1| hypothetical protein MIMGU_mgv1a006264mg [Mimulus... 56 6e-06 >gb|EYU35639.1| hypothetical protein MIMGU_mgv1a006264mg [Mimulus guttatus] Length = 450 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 3/61 (4%) Frame = -2 Query: 298 PTVIGNYGSQEAYSGLGAYQNPQAGLSS---IXXXXXXXXXTKVPTSGASASTQFPSYFK 128 P++IGNYGSQ A GLGA+QN Q G SS + P+SG SA T FP+YF Sbjct: 390 PSMIGNYGSQAALLGLGAFQNNQTGQSSSIGTGGAPTPTATIRPPSSGVSAPTNFPTYFN 449 Query: 127 R 125 R Sbjct: 450 R 450