BLASTX nr result
ID: Mentha28_contig00001504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00001504 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004487630.1| PREDICTED: chitin-inducible gibberellin-resp... 86 4e-15 ref|XP_007149678.1| hypothetical protein PHAVU_005G089900g [Phas... 85 9e-15 ref|XP_007132993.1| hypothetical protein PHAVU_011G142300g [Phas... 84 2e-14 ref|XP_003526176.1| PREDICTED: chitin-inducible gibberellin-resp... 84 2e-14 ref|XP_006592888.1| PREDICTED: chitin-inducible gibberellin-resp... 84 3e-14 ref|XP_003540429.1| PREDICTED: chitin-inducible gibberellin-resp... 84 3e-14 ref|XP_003596568.1| GRAS family transcription factor [Medicago t... 84 3e-14 ref|XP_007021113.1| GRAS family transcription factor isoform 4, ... 83 4e-14 ref|XP_007021111.1| GRAS family transcription factor isoform 2 [... 83 4e-14 ref|XP_007021110.1| GRAS family transcription factor isoform 1 [... 83 4e-14 dbj|BAI94488.1| GRAS family transcription factor [Dianthus caryo... 83 5e-14 ref|XP_007214671.1| hypothetical protein PRUPE_ppa003323mg [Prun... 82 6e-14 ref|XP_003543283.1| PREDICTED: chitin-inducible gibberellin-resp... 82 6e-14 ref|NP_001234168.1| GRAS2 protein [Solanum lycopersicum] gi|8947... 82 6e-14 gb|AAZ77752.1| SCARECROW-like protein [Solanum lycopersicum] 82 6e-14 gb|EXB50930.1| hypothetical protein L484_021158 [Morus notabilis] 82 8e-14 ref|XP_004294325.1| PREDICTED: chitin-inducible gibberellin-resp... 82 8e-14 gb|EYU19196.1| hypothetical protein MIMGU_mgv1a003912mg [Mimulus... 82 1e-13 gb|ACJ65328.1| scarecrow-like protein [Capsicum annuum] 82 1e-13 ref|XP_002522814.1| Chitin-inducible gibberellin-responsive prot... 82 1e-13 >ref|XP_004487630.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like [Cicer arietinum] Length = 578 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYSENY L+EKDGAMLLGWKNRNLISASAWH Sbjct: 534 LSSYVNSVIRSLLRCYSENYTLLEKDGAMLLGWKNRNLISASAWH 578 >ref|XP_007149678.1| hypothetical protein PHAVU_005G089900g [Phaseolus vulgaris] gi|561022942|gb|ESW21672.1| hypothetical protein PHAVU_005G089900g [Phaseolus vulgaris] Length = 582 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVIG LLKCYSE+Y L+EKDGAMLLGWK+RNLISASAWH Sbjct: 537 LSSYVNSVIGILLKCYSEHYTLLEKDGAMLLGWKDRNLISASAWH 581 >ref|XP_007132993.1| hypothetical protein PHAVU_011G142300g [Phaseolus vulgaris] gi|593261189|ref|XP_007132994.1| hypothetical protein PHAVU_011G142300g [Phaseolus vulgaris] gi|561005993|gb|ESW04987.1| hypothetical protein PHAVU_011G142300g [Phaseolus vulgaris] gi|561005994|gb|ESW04988.1| hypothetical protein PHAVU_011G142300g [Phaseolus vulgaris] Length = 565 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYSE+Y LVEKDGAMLLGWK+RNLISASAWH Sbjct: 521 LSSYVNSVIRSLLRCYSEHYNLVEKDGAMLLGWKDRNLISASAWH 565 >ref|XP_003526176.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like isoform X1 [Glycine max] gi|571462290|ref|XP_006582237.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like isoform X2 [Glycine max] gi|571462292|ref|XP_006582238.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like isoform X3 [Glycine max] Length = 568 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYSE+Y LVEKDGAMLLGWK+RNLISASAWH Sbjct: 524 LSSYVNSVIRSLLRCYSEHYNLVEKDGAMLLGWKDRNLISASAWH 568 >ref|XP_006592888.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like isoform X2 [Glycine max] Length = 485 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYSE+Y LVEKDGAMLLGWK+RNLISASAWH Sbjct: 440 LSSYVNSVIRSLLRCYSEHYTLVEKDGAMLLGWKDRNLISASAWH 484 >ref|XP_003540429.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like isoform X1 [Glycine max] Length = 571 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYSE+Y LVEKDGAMLLGWK+RNLISASAWH Sbjct: 526 LSSYVNSVIRSLLRCYSEHYTLVEKDGAMLLGWKDRNLISASAWH 570 >ref|XP_003596568.1| GRAS family transcription factor [Medicago truncatula] gi|355485616|gb|AES66819.1| GRAS family transcription factor [Medicago truncatula] Length = 579 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYSE+Y LVEKDGAMLLGWK+RNLISASAWH Sbjct: 535 LSSYVNSVIRSLLRCYSEHYTLVEKDGAMLLGWKSRNLISASAWH 579 >ref|XP_007021113.1| GRAS family transcription factor isoform 4, partial [Theobroma cacao] gi|508720741|gb|EOY12638.1| GRAS family transcription factor isoform 4, partial [Theobroma cacao] Length = 592 Score = 83.2 bits (204), Expect = 4e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYS++Y+LVEKDGAMLLGWK+RNLISASAWH Sbjct: 545 LSSYVNSVIRSLLRCYSKHYKLVEKDGAMLLGWKDRNLISASAWH 589 >ref|XP_007021111.1| GRAS family transcription factor isoform 2 [Theobroma cacao] gi|508720739|gb|EOY12636.1| GRAS family transcription factor isoform 2 [Theobroma cacao] Length = 454 Score = 83.2 bits (204), Expect = 4e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYS++Y+LVEKDGAMLLGWK+RNLISASAWH Sbjct: 407 LSSYVNSVIRSLLRCYSKHYKLVEKDGAMLLGWKDRNLISASAWH 451 >ref|XP_007021110.1| GRAS family transcription factor isoform 1 [Theobroma cacao] gi|590607882|ref|XP_007021112.1| GRAS family transcription factor isoform 1 [Theobroma cacao] gi|508720738|gb|EOY12635.1| GRAS family transcription factor isoform 1 [Theobroma cacao] gi|508720740|gb|EOY12637.1| GRAS family transcription factor isoform 1 [Theobroma cacao] Length = 596 Score = 83.2 bits (204), Expect = 4e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYS++Y+LVEKDGAMLLGWK+RNLISASAWH Sbjct: 549 LSSYVNSVIRSLLRCYSKHYKLVEKDGAMLLGWKDRNLISASAWH 593 >dbj|BAI94488.1| GRAS family transcription factor [Dianthus caryophyllus] Length = 573 Score = 82.8 bits (203), Expect = 5e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI GLL+CYSE+Y LVEKDGAMLLGWK+R LISASAWH Sbjct: 529 LSSYVNSVIRGLLRCYSEHYTLVEKDGAMLLGWKDRMLISASAWH 573 >ref|XP_007214671.1| hypothetical protein PRUPE_ppa003323mg [Prunus persica] gi|462410536|gb|EMJ15870.1| hypothetical protein PRUPE_ppa003323mg [Prunus persica] Length = 585 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYSE+Y LVE+DGAMLLGWK+RNLISASAWH Sbjct: 541 LSSYVNSVIRSLLRCYSEHYTLVERDGAMLLGWKDRNLISASAWH 585 >ref|XP_003543283.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like [Glycine max] Length = 577 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL CYSE+Y LVEKDGAMLLGWK+RNLISASAWH Sbjct: 532 LSSYVNSVIRSLLMCYSEHYTLVEKDGAMLLGWKDRNLISASAWH 576 >ref|NP_001234168.1| GRAS2 protein [Solanum lycopersicum] gi|89474464|gb|ABD72959.1| GRAS2 [Solanum lycopersicum] Length = 583 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI L++CYSE+Y LVEKDGAMLLGWK RNLISASAWH Sbjct: 539 LSSYVNSVIKSLMRCYSEHYTLVEKDGAMLLGWKKRNLISASAWH 583 >gb|AAZ77752.1| SCARECROW-like protein [Solanum lycopersicum] Length = 71 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI L++CYSE+Y LVEKDGAMLLGWK RNLISASAWH Sbjct: 27 LSSYVNSVIKSLMRCYSEHYTLVEKDGAMLLGWKKRNLISASAWH 71 >gb|EXB50930.1| hypothetical protein L484_021158 [Morus notabilis] Length = 581 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYSE+Y L EKDGAMLLGWK+RNLISASAWH Sbjct: 537 LSSYVNSVIRSLLRCYSEHYTLAEKDGAMLLGWKDRNLISASAWH 581 >ref|XP_004294325.1| PREDICTED: chitin-inducible gibberellin-responsive protein 1-like [Fragaria vesca subsp. vesca] Length = 576 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYSE+Y+L EKDGAMLLGWK+RNL+SASAWH Sbjct: 532 LSSYVNSVIRSLLRCYSEHYKLEEKDGAMLLGWKDRNLVSASAWH 576 >gb|EYU19196.1| hypothetical protein MIMGU_mgv1a003912mg [Mimulus guttatus] Length = 555 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LS YVNSVIGGLL+ YSE+Y LVEKDG MLLGWK+RNL+SASAWH Sbjct: 511 LSGYVNSVIGGLLRSYSEHYTLVEKDGGMLLGWKDRNLVSASAWH 555 >gb|ACJ65328.1| scarecrow-like protein [Capsicum annuum] Length = 582 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYS++Y LVEKDGAMLLGWK RNLISASAWH Sbjct: 538 LSSYVNSVIKSLLRCYSKHYTLVEKDGAMLLGWKERNLISASAWH 582 >ref|XP_002522814.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus communis] gi|223537898|gb|EEF39512.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus communis] Length = 459 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 LSSYVNSVIGGLLKCYSENYRLVEKDGAMLLGWKNRNLISASAWH 135 LSSYVNSVI LL+CYSE+Y L+EKDGAMLLGWKNRNL+SASAW+ Sbjct: 415 LSSYVNSVIRSLLRCYSEHYTLLEKDGAMLLGWKNRNLVSASAWY 459