BLASTX nr result
ID: Mentha28_contig00000496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00000496 (582 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR92329.1| putative metallothionin 2a [Salvia miltiorrhiza] 70 4e-10 >gb|ABR92329.1| putative metallothionin 2a [Salvia miltiorrhiza] Length = 80 Score = 70.1 bits (170), Expect = 4e-10 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -2 Query: 476 MYPDLSYSEAAGAGETLVLGVAPQKTYFEGSESVMGEAE 360 MYPDLSYSEA+GA ETLVLGVAPQKTYFEGSE MGE E Sbjct: 25 MYPDLSYSEASGAAETLVLGVAPQKTYFEGSEMGMGEDE 63