BLASTX nr result
ID: Mentha28_contig00000468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00000468 (484 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42179.1| hypothetical protein MIMGU_mgv1a0200121mg, partia... 70 3e-10 >gb|EYU42179.1| hypothetical protein MIMGU_mgv1a0200121mg, partial [Mimulus guttatus] Length = 160 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/61 (62%), Positives = 42/61 (68%) Frame = -1 Query: 349 IRGYMDSTELTVFGARGLYATNRGNNESLGRLRDVNNSPLKVWNEFWKSMYGNVQFPPNS 170 IR YMDSTEL VF ARGL+ +R NE LG + V SPLKVWN WKS+ GN FP NS Sbjct: 96 IRSYMDSTELMVFAARGLFENHR-TNECLGSVDGV--SPLKVWNNIWKSVSGNDHFPLNS 152 Query: 169 V 167 V Sbjct: 153 V 153