BLASTX nr result
ID: Mentha28_contig00000458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00000458 (563 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR92329.1| putative metallothionin 2a [Salvia miltiorrhiza] 64 2e-08 >gb|ABR92329.1| putative metallothionin 2a [Salvia miltiorrhiza] Length = 80 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 426 MYPDLSYSEAAGAGETLVLGVAPQKTYFEGSGSVMG 319 MYPDLSYSEA+GA ETLVLGVAPQKTYFEGS MG Sbjct: 25 MYPDLSYSEASGAAETLVLGVAPQKTYFEGSEMGMG 60