BLASTX nr result
ID: Mentha27_contig00050911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00050911 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21751.1| hypothetical protein MIMGU_mgv1a001232mg [Mimulus... 57 2e-06 >gb|EYU21751.1| hypothetical protein MIMGU_mgv1a001232mg [Mimulus guttatus] Length = 859 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/63 (55%), Positives = 41/63 (65%), Gaps = 3/63 (4%) Frame = +2 Query: 92 NFQELDLVGNFRLLRVLDNLDAMNNHKKL---LPSQVFELIHLRFLALSSFVRIPSTISN 262 N L VGN RLLRVLD +DA + L LPS++FEL HLR+LA S IPS ISN Sbjct: 532 NASSLGFVGNIRLLRVLDVVDANFSPFILYVSLPSKLFELFHLRYLAFSYPTTIPSDISN 591 Query: 263 LKN 271 L+N Sbjct: 592 LQN 594