BLASTX nr result
ID: Mentha27_contig00050844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00050844 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38153.1| hypothetical protein MIMGU_mgv1a000908mg [Mimulus... 57 2e-06 >gb|EYU38153.1| hypothetical protein MIMGU_mgv1a000908mg [Mimulus guttatus] Length = 945 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/86 (40%), Positives = 50/86 (58%) Frame = +3 Query: 3 AIPENKSKYNGSFKPEVASTKFVATREINTTAEGPVFPSVHTFPSTSNIRTQNAEEPRKD 182 A+P + S N S K +V+S +I+ T++G P +HTFPSTS+IR Q A+E Sbjct: 828 ALPNSSSMCNVSTKHDVSSAP-----DISKTSQGVSAPPMHTFPSTSSIRKQKADE---- 878 Query: 183 KNGKTEENKTVTSERTIDLKTEGKVS 260 NGK E+N V SE+T + KV+ Sbjct: 879 GNGKNEQNHIVASEKTTSVVETKKVT 904