BLASTX nr result
ID: Mentha27_contig00050569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00050569 (212 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32798.1| hypothetical protein MIMGU_mgv1a010138mg [Mimulus... 59 7e-07 >gb|EYU32798.1| hypothetical protein MIMGU_mgv1a010138mg [Mimulus guttatus] Length = 321 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/51 (49%), Positives = 42/51 (82%) Frame = -1 Query: 155 NRKMWRKRSLILEEILEGLRNYSSISNLGAELKRLRPLLVQRLEERARDHP 3 N ++W+K SLILE++L G R YS+ SN +L++LRP++++R+EERA+++P Sbjct: 5 NLRLWQKSSLILEQVLIGSRFYSTKSNPTVDLRKLRPVILKRIEERAKEYP 55