BLASTX nr result
ID: Mentha27_contig00050373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00050373 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44864.1| hypothetical protein MIMGU_mgv1a011922mg [Mimulus... 60 2e-07 >gb|EYU44864.1| hypothetical protein MIMGU_mgv1a011922mg [Mimulus guttatus] Length = 266 Score = 60.5 bits (145), Expect = 2e-07 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 4/76 (5%) Frame = +2 Query: 20 LHDDSAMRLANSRILSLPSLEMPRGIGLSLEDRLEPMVLDEAEQEQLYDRPS----TSKV 187 + S + L+++R S+PS E+ G G SLEDRLEPMVL+E E+EQ RPS +S + Sbjct: 1 MESGSVVSLSSNRSHSVPSAEIFCGTGFSLEDRLEPMVLNEDEEEQPNARPSKENISSNM 60 Query: 188 QWPIRVVELNSVVNQS 235 PI+ VE +SV N S Sbjct: 61 HGPIQDVEFDSVANPS 76