BLASTX nr result
ID: Mentha27_contig00050251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00050251 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006368027.1| PREDICTED: putative RING-H2 finger protein A... 67 3e-09 ref|XP_006339703.1| PREDICTED: putative RING-H2 finger protein A... 67 3e-09 ref|XP_004231220.1| PREDICTED: putative RING-H2 finger protein A... 66 4e-09 ref|XP_003529891.1| PREDICTED: putative RING-H2 finger protein A... 64 2e-08 ref|XP_004231219.1| PREDICTED: putative RING-H2 finger protein A... 63 4e-08 ref|XP_006339800.1| PREDICTED: putative RING-H2 finger protein A... 62 1e-07 gb|EXB62190.1| Putative RING-H2 finger protein ATL21A [Morus not... 61 2e-07 gb|AFK44003.1| unknown [Medicago truncatula] 61 2e-07 ref|XP_003638664.1| RING finger protein [Medicago truncatula] gi... 61 2e-07 ref|XP_003636978.1| RING-H2 finger protein ATL1E, partial [Medic... 61 2e-07 ref|XP_002277387.1| PREDICTED: putative RING-H2 finger protein A... 59 5e-07 ref|XP_002277411.1| PREDICTED: putative RING-H2 finger protein A... 58 2e-06 gb|EYU32242.1| hypothetical protein MIMGU_mgv1a008365mg [Mimulus... 57 2e-06 ref|XP_003548419.1| PREDICTED: putative RING-H2 finger protein A... 57 3e-06 ref|XP_004510676.1| PREDICTED: putative RING-H2 finger protein A... 57 4e-06 ref|XP_007219990.1| hypothetical protein PRUPE_ppb022242mg [Prun... 56 5e-06 ref|XP_006444855.1| hypothetical protein CICLE_v10020705mg [Citr... 56 6e-06 ref|XP_004306676.1| PREDICTED: putative RING-H2 finger protein A... 56 6e-06 ref|XP_007135253.1| hypothetical protein PHAVU_010G113700g [Phas... 55 8e-06 >ref|XP_006368027.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Solanum tuberosum] Length = 374 Score = 67.0 bits (162), Expect = 3e-09 Identities = 39/85 (45%), Positives = 55/85 (64%), Gaps = 3/85 (3%) Frame = -1 Query: 246 LMFFV-FLLDSTVCSKISVQAPT-CGNNTFFIQYPFKLVQEVQIPHHISP-YDLKCNNQG 76 L+FFV FLL S+V + + CGNN F I++PF L + H P ++LKCNNQG Sbjct: 5 LVFFVYFLLFSSVYANYDCPLDSICGNNRFDIRFPFGLQGPQNLQHCTYPGFNLKCNNQG 64 Query: 75 IVALSLPFSGEFYIRNIDYFQQKIQ 1 L+LP +G+FY+R+I+Y Q+IQ Sbjct: 65 KGNLNLPGAGDFYVRDINYLTQEIQ 89 >ref|XP_006339703.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Solanum tuberosum] Length = 372 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/88 (39%), Positives = 53/88 (60%), Gaps = 1/88 (1%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISP-YDLKCN 85 M +L + F FLL TV ++ CGNN F I++PF + + + P + L+C+ Sbjct: 1 MDILKFISFSFLLCLTVYARYDCPDSICGNNHFDIRFPFGIEGRQNLQNCSYPGFSLRCS 60 Query: 84 NQGIVALSLPFSGEFYIRNIDYFQQKIQ 1 NQG LSLP +G++Y+R+IDY Q+IQ Sbjct: 61 NQGRSILSLPGAGDYYVRDIDYLTQEIQ 88 >ref|XP_004231220.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Solanum lycopersicum] Length = 372 Score = 66.2 bits (160), Expect = 4e-09 Identities = 36/88 (40%), Positives = 53/88 (60%), Gaps = 1/88 (1%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISP-YDLKCN 85 M +L + F FLL TV ++ TCGNN F I++PF + + + P + L C+ Sbjct: 1 MDILKFISFSFLLCLTVYARYDCPDSTCGNNHFDIRFPFGIEGSQNLQNCSYPGFSLICS 60 Query: 84 NQGIVALSLPFSGEFYIRNIDYFQQKIQ 1 NQG LSLP +G++Y+R+IDY Q+IQ Sbjct: 61 NQGRSILSLPGAGDYYVRDIDYQTQEIQ 88 >ref|XP_003529891.1| PREDICTED: putative RING-H2 finger protein ATL21A-like isoform X1 [Glycine max] Length = 372 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 2/89 (2%) Frame = -1 Query: 261 MGLLPLMF--FVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISPYDLKC 88 MG+L ++F FVF + V + Q CGNN+ I++PF+L + ++L C Sbjct: 1 MGILEVLFPFFVFPVIYAVATSNDCQFSVCGNNSVLIRFPFQLDGDRNPYCGYPGFNLTC 60 Query: 87 NNQGIVALSLPFSGEFYIRNIDYFQQKIQ 1 N L LP+SG FY+R+I+Y QKIQ Sbjct: 61 TNNSKTVLKLPYSGAFYVRSINYLTQKIQ 89 >ref|XP_004231219.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Solanum lycopersicum] Length = 370 Score = 63.2 bits (152), Expect = 4e-08 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%) Frame = -1 Query: 246 LMFFV-FLLDSTVCSKISVQAPT-CGNNTFFIQYPFKLVQEVQIPHHISP-YDLKCNNQG 76 L+FFV FL S+V + + CGNN F I++PF L + P +P +++KCNNQG Sbjct: 5 LVFFVSFLFFSSVYGDRNCPLDSICGNNRFDIRFPFGLEE----PCTYNPSFNIKCNNQG 60 Query: 75 IVALSLPFSGEFYIRNIDYFQQKIQ 1 LSLP +G+FY+R+I+Y Q+IQ Sbjct: 61 RAILSLPGAGDFYVRDINYLMQEIQ 85 >ref|XP_006339800.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Solanum tuberosum] Length = 345 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/93 (36%), Positives = 56/93 (60%), Gaps = 3/93 (3%) Frame = -1 Query: 270 LNNMGLLPLMFFVF--LLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISP-Y 100 ++N+ +L + F +F + C +S+ CGNN F I++PF L +P + Sbjct: 1 MDNLLVLSVSFLLFSSVYAKNDCPGVSI----CGNNPFEIRFPFGLESPQNQHCTYNPGF 56 Query: 99 DLKCNNQGIVALSLPFSGEFYIRNIDYFQQKIQ 1 +LKCNNQG ++LP +G+FY+R+I+Y Q+IQ Sbjct: 57 NLKCNNQGKAIINLPGAGDFYVRDINYLTQQIQ 89 >gb|EXB62190.1| Putative RING-H2 finger protein ATL21A [Morus notabilis] Length = 376 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 1/87 (1%) Frame = -1 Query: 261 MGLLPLMFF-VFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISPYDLKCN 85 MG + ++FF +F L + + Q C N + I++PF+L + +DL CN Sbjct: 1 MGTIDVLFFLIFFLFPIIFASEECQISMCDNKSIPIRFPFQLEGQNLQNCGYPGFDLTCN 60 Query: 84 NQGIVALSLPFSGEFYIRNIDYFQQKI 4 +Q + L LPFSGEF++R I Y Q+I Sbjct: 61 SQNLTVLKLPFSGEFFVRQISYITQEI 87 >gb|AFK44003.1| unknown [Medicago truncatula] Length = 371 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/88 (37%), Positives = 53/88 (60%), Gaps = 1/88 (1%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISP-YDLKCN 85 M +L ++F+ L+ V + CGNN+F I++PF+L + Q P+ + P ++L C Sbjct: 1 MDILKVLFY--LIFPVVYALNDCPFSLCGNNSFLIRFPFQLGE--QYPYCVYPGFNLSCT 56 Query: 84 NQGIVALSLPFSGEFYIRNIDYFQQKIQ 1 N L LP+S EFY+R+I+Y Q+IQ Sbjct: 57 NDSKTILKLPYSEEFYVRSINYLTQQIQ 84 >ref|XP_003638664.1| RING finger protein [Medicago truncatula] gi|355504599|gb|AES85802.1| RING finger protein [Medicago truncatula] Length = 371 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/88 (37%), Positives = 53/88 (60%), Gaps = 1/88 (1%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISP-YDLKCN 85 M +L ++F+ L+ V + CGNN+F I++PF+L + Q P+ + P ++L C Sbjct: 1 MDILKVLFY--LIFPVVYALNDCPFSLCGNNSFLIRFPFQLGE--QYPYCVYPGFNLSCT 56 Query: 84 NQGIVALSLPFSGEFYIRNIDYFQQKIQ 1 N L LP+S EFY+R+I+Y Q+IQ Sbjct: 57 NDSKTILKLPYSEEFYVRSINYLTQQIQ 84 >ref|XP_003636978.1| RING-H2 finger protein ATL1E, partial [Medicago truncatula] gi|355502913|gb|AES84116.1| RING-H2 finger protein ATL1E, partial [Medicago truncatula] Length = 203 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/88 (37%), Positives = 53/88 (60%), Gaps = 1/88 (1%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISP-YDLKCN 85 M +L ++F+ L+ V + CGNN+F I++PF+L + Q P+ + P ++L C Sbjct: 1 MDILKVLFY--LIFPVVYALNDCPFSLCGNNSFLIRFPFQLGE--QYPYCVYPGFNLSCT 56 Query: 84 NQGIVALSLPFSGEFYIRNIDYFQQKIQ 1 N L LP+S EFY+R+I+Y Q+IQ Sbjct: 57 NDSKTILKLPYSEEFYVRSINYLTQQIQ 84 >ref|XP_002277387.1| PREDICTED: putative RING-H2 finger protein ATL21A [Vitis vinifera] gi|297745433|emb|CBI40513.3| unnamed protein product [Vitis vinifera] Length = 372 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/87 (33%), Positives = 47/87 (54%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISPYDLKCNN 82 M L + FF+F + + ++ + CG+N I +PF LV + ++L C + Sbjct: 1 MAFLDIFFFLFSVFPLILAREACPVSRCGSNGSTIGFPFHLVGQQHQNCGYPGFNLSCGS 60 Query: 81 QGIVALSLPFSGEFYIRNIDYFQQKIQ 1 GI L LP+ GEF++R I+Y Q+IQ Sbjct: 61 PGITVLRLPYWGEFFVRGINYITQEIQ 87 >ref|XP_002277411.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Vitis vinifera] Length = 334 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/87 (33%), Positives = 46/87 (52%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISPYDLKCNN 82 M L + FF+F + + ++ S CG+N I +PF LV + ++L C + Sbjct: 1 MAFLDIFFFLFSVFPLILARESCPVSRCGSNGCTIGFPFHLVGQQHQNCGYPGFNLSCGS 60 Query: 81 QGIVALSLPFSGEFYIRNIDYFQQKIQ 1 I L LP+ GEF++R I+Y Q+IQ Sbjct: 61 PDITVLRLPYWGEFFVRGINYITQEIQ 87 >gb|EYU32242.1| hypothetical protein MIMGU_mgv1a008365mg [Mimulus guttatus] Length = 376 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 9/94 (9%) Frame = -1 Query: 255 LLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISP-YDLKC--- 88 LL +FF L T+ S+ + +CG N F +++PF+L E Q P +DL C Sbjct: 4 LLRTIFFALFLFQTIQSQNDCRFQSCGENQFLVRFPFRLRGEKQPERCGYPGFDLICTTT 63 Query: 87 -----NNQGIVALSLPFSGEFYIRNIDYFQQKIQ 1 N + L+LP+SG+F IR+I+Y Q+IQ Sbjct: 64 TYNNKRNSQVPLLNLPYSGDFVIRDINYLTQEIQ 97 >ref|XP_003548419.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Glycine max] Length = 378 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 1/88 (1%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISPYDLKCNN 82 MG+L ++F F+ + Q CGNN+ I++PF+L + ++L C N Sbjct: 1 MGILEVLFPFFVFPVIYAASNDCQFSLCGNNSILIRFPFQLEGDRNPYCGYPGFNLTCTN 60 Query: 81 QGIVALSLPFS-GEFYIRNIDYFQQKIQ 1 L P+S G FY+R+I+Y QKIQ Sbjct: 61 SSKTVLKFPYSRGAFYVRSINYLTQKIQ 88 >ref|XP_004510676.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Cicer arietinum] Length = 374 Score = 56.6 bits (135), Expect = 4e-06 Identities = 33/87 (37%), Positives = 51/87 (58%), Gaps = 1/87 (1%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISP-YDLKCN 85 MG+L L+F+ L + + Q CGNNTF I++PF+L Q P+ P ++L C Sbjct: 1 MGILKLLFY--LTFPVIYAFNDCQFYLCGNNTFLIRFPFQLGG--QYPYCGYPGFNLICT 56 Query: 84 NQGIVALSLPFSGEFYIRNIDYFQQKI 4 N L LP+S +FY+R+I+Y Q++ Sbjct: 57 NSSKTVLKLPYSEKFYVRSINYLTQQL 83 >ref|XP_007219990.1| hypothetical protein PRUPE_ppb022242mg [Prunus persica] gi|462416452|gb|EMJ21189.1| hypothetical protein PRUPE_ppb022242mg [Prunus persica] Length = 375 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/87 (32%), Positives = 45/87 (51%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISPYDLKCNN 82 M +L + F + L + ++ CG F I++PF+L ++L CN+ Sbjct: 1 MDILDIFFALLFLFPHIYARDDCPVSVCGYTGFPIRFPFRLQARQPENCGYPGFNLTCNS 60 Query: 81 QGIVALSLPFSGEFYIRNIDYFQQKIQ 1 QG+ + LP SGEF++R I Y Q+IQ Sbjct: 61 QGLTVIKLPLSGEFFVRAISYATQEIQ 87 >ref|XP_006444855.1| hypothetical protein CICLE_v10020705mg [Citrus clementina] gi|568876401|ref|XP_006491268.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Citrus sinensis] gi|557547117|gb|ESR58095.1| hypothetical protein CICLE_v10020705mg [Citrus clementina] Length = 369 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/86 (37%), Positives = 51/86 (59%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISPYDLKCNN 82 M ++ + FF+F L S + S+ S Q C +N +++PF+L + ++L C + Sbjct: 1 MCIIQVFFFLFFLFSFIHSE-SCQVHFCADN-IPVRFPFQLHGKQPENCSYPGFNLTCTS 58 Query: 81 QGIVALSLPFSGEFYIRNIDYFQQKI 4 QGI L LP SGEF++RNI+Y Q+I Sbjct: 59 QGITVLKLPNSGEFFVRNINYITQQI 84 >ref|XP_004306676.1| PREDICTED: putative RING-H2 finger protein ATL21A-like [Fragaria vesca subsp. vesca] Length = 372 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/64 (48%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Frame = -1 Query: 189 APTCGNNTFFIQYPFKLVQEVQIPHHISP-YDLKCNNQGIVALSLPFSGEFYIRNIDYFQ 13 A CGN F I++PF L Q Q + P +DL CN QG +SLP SGEF++R IDY Sbjct: 27 ASMCGNTGFPIRFPFGL-QGYQPKNCSYPGFDLTCNTQGTTVISLPNSGEFFVRAIDYVT 85 Query: 12 QKIQ 1 Q+I+ Sbjct: 86 QEIK 89 >ref|XP_007135253.1| hypothetical protein PHAVU_010G113700g [Phaseolus vulgaris] gi|561008298|gb|ESW07247.1| hypothetical protein PHAVU_010G113700g [Phaseolus vulgaris] Length = 374 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/88 (37%), Positives = 49/88 (55%), Gaps = 1/88 (1%) Frame = -1 Query: 261 MGLLPLMFFVFLLDSTVCSKISVQAPTCGNNTFFIQYPFKLVQEVQIPHHISP-YDLKCN 85 MG+L ++F F+ S + CG+N I++PF+ + Q P+ P ++L C Sbjct: 1 MGILEVLFPFFIFPVIYASS-DCRFSFCGSNGIIIRFPFQQ-EGKQNPYCGYPGFNLICT 58 Query: 84 NQGIVALSLPFSGEFYIRNIDYFQQKIQ 1 N L LP+SG FY+RNI+Y QKIQ Sbjct: 59 NNSKTVLKLPYSGLFYVRNINYLTQKIQ 86