BLASTX nr result
ID: Mentha27_contig00050095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00050095 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44609.1| hypothetical protein MIMGU_mgv1a007083mg [Mimulus... 62 6e-08 >gb|EYU44609.1| hypothetical protein MIMGU_mgv1a007083mg [Mimulus guttatus] Length = 420 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +2 Query: 2 FAVKPESVGTALLGPKSESWFCDALKSTGILQKGQSADCG 121 F VKPESVG+ALL PKSESWFCDALK T +LQKG G Sbjct: 129 FPVKPESVGSALLDPKSESWFCDALKGTRMLQKGHEISVG 168