BLASTX nr result
ID: Mentha27_contig00050041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00050041 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24863.1| hypothetical protein MIMGU_mgv1a005316mg [Mimulus... 77 2e-12 gb|EYU26096.1| hypothetical protein MIMGU_mgv1a005244mg [Mimulus... 73 4e-11 gb|EPS62071.1| hypothetical protein M569_12716, partial [Genlise... 73 5e-11 gb|EXB62315.1| Diacylglycerol kinase iota [Morus notabilis] 71 2e-10 gb|EXB39281.1| Diacylglycerol kinase iota [Morus notabilis] 71 2e-10 ref|XP_004139963.1| PREDICTED: diacylglycerol kinase iota-like [... 71 2e-10 gb|EYU37383.1| hypothetical protein MIMGU_mgv1a024369mg [Mimulus... 70 2e-10 gb|EYU26770.1| hypothetical protein MIMGU_mgv1a025204mg, partial... 70 2e-10 ref|XP_006365995.1| PREDICTED: diacylglycerol kinase 5-like isof... 70 2e-10 ref|XP_006365994.1| PREDICTED: diacylglycerol kinase 5-like isof... 70 2e-10 ref|XP_006365993.1| PREDICTED: diacylglycerol kinase 5-like isof... 70 2e-10 ref|XP_006357549.1| PREDICTED: diacylglycerol kinase 5-like isof... 69 9e-10 ref|XP_006357548.1| PREDICTED: diacylglycerol kinase 5-like isof... 69 9e-10 ref|XP_006357547.1| PREDICTED: diacylglycerol kinase 5-like isof... 69 9e-10 ref|XP_004248144.1| PREDICTED: diacylglycerol kinase iota-like [... 69 9e-10 gb|AAG23130.1| diacylglycerol kinase variant A [Solanum lycopers... 69 9e-10 gb|AAG23129.1|AF198259_1 diacylglycerol kinase [Solanum lycopers... 69 9e-10 gb|AAG23131.1| diacylglycerol kinase variant B [Solanum lycopers... 69 9e-10 ref|NP_001234476.1| calmodulin-binding diacylglycerol kinase [So... 69 9e-10 ref|XP_006652876.1| PREDICTED: diacylglycerol kinase 5-like [Ory... 67 2e-09 >gb|EYU24863.1| hypothetical protein MIMGU_mgv1a005316mg [Mimulus guttatus] Length = 489 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/60 (60%), Positives = 46/60 (76%) Frame = +3 Query: 66 YIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 Y + N ++ L EE P+ VLRR+F+NL +LKN GDE+ASE+EK LK+IVAGGDG AGW Sbjct: 59 YRTVLNEKQVIDLGEEAPDGVLRRLFVNLEKLKNNGDEVASELEKKLKIIVAGGDGTAGW 118 >gb|EYU26096.1| hypothetical protein MIMGU_mgv1a005244mg [Mimulus guttatus] Length = 492 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/60 (58%), Positives = 43/60 (71%) Frame = +3 Query: 66 YIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 Y L N + L EE P+SVLRRVFLNL RLKN GD+ A ++E+ ++IVAGGDG AGW Sbjct: 63 YRSLLNKDQVFDLSEEAPDSVLRRVFLNLERLKNNGDQFAPKLEEKFRIIVAGGDGTAGW 122 >gb|EPS62071.1| hypothetical protein M569_12716, partial [Genlisea aurea] Length = 478 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 1/61 (1%) Frame = +3 Query: 66 YIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGD-EIASEIEKNLKLIVAGGDGMAG 242 Y + N S ++ L +E P++VLRRVFLNL RLKN GD E A ++EKN+++IVAGGDG AG Sbjct: 50 YRSILNESQVIDLGKEAPDAVLRRVFLNLERLKNNGDEEFAPKLEKNMRIIVAGGDGTAG 109 Query: 243 W 245 W Sbjct: 110 W 110 >gb|EXB62315.1| Diacylglycerol kinase iota [Morus notabilis] Length = 487 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/60 (53%), Positives = 46/60 (76%) Frame = +3 Query: 66 YIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 Y + N + + L +E P+ VLRR+++NL RLK++GD++A IE+NL+LIVAGGDG AGW Sbjct: 57 YRSILNENQVFDLGQEAPDVVLRRIYVNLERLKSEGDKLAKHIEENLRLIVAGGDGTAGW 116 >gb|EXB39281.1| Diacylglycerol kinase iota [Morus notabilis] Length = 286 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/60 (53%), Positives = 46/60 (76%) Frame = +3 Query: 66 YIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 Y + N + + L +E P+ VLRR+++NL RLK++GD++A IE+NL+LIVAGGDG AGW Sbjct: 57 YRSILNENQVFDLGQEAPDVVLRRIYVNLERLKSEGDKLAKHIEENLRLIVAGGDGTAGW 116 >ref|XP_004139963.1| PREDICTED: diacylglycerol kinase iota-like [Cucumis sativus] Length = 486 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/60 (58%), Positives = 43/60 (71%) Frame = +3 Query: 66 YIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 Y L N + L EE P++VLRR FLNL +LK GDE+A +I+K L+LIVAGGDG AGW Sbjct: 59 YRSLLNEKQVFDLGEEAPDAVLRRFFLNLEKLKLNGDEVAVDIQKKLRLIVAGGDGTAGW 118 >gb|EYU37383.1| hypothetical protein MIMGU_mgv1a024369mg [Mimulus guttatus] Length = 454 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = +3 Query: 99 LLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 L+ EE P+SVLRRVFLNL LKN GDE ++E+ LK++VAGGDG AGW Sbjct: 72 LVGEEAPDSVLRRVFLNLEMLKNNGDEFVPKLEEKLKIVVAGGDGTAGW 120 >gb|EYU26770.1| hypothetical protein MIMGU_mgv1a025204mg, partial [Mimulus guttatus] Length = 239 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = +3 Query: 90 YILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 ++ L EE P+SVLRRVFLNL LKN GDE ++E+ LK++VAGGDG AGW Sbjct: 1 HVFDLGEEAPDSVLRRVFLNLEMLKNNGDEFVPKLEEKLKIVVAGGDGTAGW 52 >ref|XP_006365995.1| PREDICTED: diacylglycerol kinase 5-like isoform X3 [Solanum tuberosum] gi|565400983|ref|XP_006365996.1| PREDICTED: diacylglycerol kinase 5-like isoform X4 [Solanum tuberosum] Length = 493 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/60 (55%), Positives = 45/60 (75%) Frame = +3 Query: 66 YIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 Y L N + L +ETP+SVL R++LNL +LKN GDE A+++E+ L++IVAGGDG AGW Sbjct: 63 YQSLLNKYQVFDLGKETPDSVLHRLYLNLEKLKNNGDEFAAKLEERLRIIVAGGDGTAGW 122 >ref|XP_006365994.1| PREDICTED: diacylglycerol kinase 5-like isoform X2 [Solanum tuberosum] Length = 500 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/60 (55%), Positives = 45/60 (75%) Frame = +3 Query: 66 YIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 Y L N + L +ETP+SVL R++LNL +LKN GDE A+++E+ L++IVAGGDG AGW Sbjct: 70 YQSLLNKYQVFDLGKETPDSVLHRLYLNLEKLKNNGDEFAAKLEERLRIIVAGGDGTAGW 129 >ref|XP_006365993.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Solanum tuberosum] Length = 502 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/60 (55%), Positives = 45/60 (75%) Frame = +3 Query: 66 YIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 Y L N + L +ETP+SVL R++LNL +LKN GDE A+++E+ L++IVAGGDG AGW Sbjct: 72 YQSLLNKYQVFDLGKETPDSVLHRLYLNLEKLKNNGDEFAAKLEERLRIIVAGGDGTAGW 131 >ref|XP_006357549.1| PREDICTED: diacylglycerol kinase 5-like isoform X3 [Solanum tuberosum] Length = 544 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = +3 Query: 75 LTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 L N + L EE P+SVLRR++LN+ RLK GD A+EIE+ +++IVAGGDG AGW Sbjct: 97 LLNKYQVFDLGEEAPDSVLRRLYLNIERLKGNGDRFAAEIEERMRIIVAGGDGTAGW 153 >ref|XP_006357548.1| PREDICTED: diacylglycerol kinase 5-like isoform X2 [Solanum tuberosum] Length = 489 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = +3 Query: 75 LTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 L N + L EE P+SVLRR++LN+ RLK GD A+EIE+ +++IVAGGDG AGW Sbjct: 64 LLNKYQVFDLGEEAPDSVLRRLYLNIERLKGNGDRFAAEIEERMRIIVAGGDGTAGW 120 >ref|XP_006357547.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Solanum tuberosum] Length = 522 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = +3 Query: 75 LTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 L N + L EE P+SVLRR++LN+ RLK GD A+EIE+ +++IVAGGDG AGW Sbjct: 97 LLNKYQVFDLGEEAPDSVLRRLYLNIERLKGNGDRFAAEIEERMRIIVAGGDGTAGW 153 >ref|XP_004248144.1| PREDICTED: diacylglycerol kinase iota-like [Solanum lycopersicum] Length = 493 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = +3 Query: 66 YIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 Y L N + L +ETP+SVLRR++LNL +LK+ GD+ A ++E+ L++IVAGGDG AGW Sbjct: 63 YQSLLNKDQVFDLGKETPDSVLRRLYLNLEKLKSNGDKFAVKLEERLRIIVAGGDGTAGW 122 >gb|AAG23130.1| diacylglycerol kinase variant A [Solanum lycopersicum] Length = 489 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = +3 Query: 75 LTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 L N + L +E P+SVLRR++LN+ RLK GD A+EIE+ +K+IVAGGDG AGW Sbjct: 64 LLNKYQVFDLGDEAPDSVLRRLYLNIERLKGNGDHFAAEIEERMKIIVAGGDGTAGW 120 >gb|AAG23129.1|AF198259_1 diacylglycerol kinase [Solanum lycopersicum] Length = 489 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = +3 Query: 75 LTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 L N + L +E P+SVLRR++LN+ RLK GD A+EIE+ +K+IVAGGDG AGW Sbjct: 64 LLNKYQVFDLGDEAPDSVLRRLYLNIERLKGNGDHFAAEIEERMKIIVAGGDGTAGW 120 >gb|AAG23131.1| diacylglycerol kinase variant B [Solanum lycopersicum] Length = 511 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = +3 Query: 75 LTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 L N + L +E P+SVLRR++LN+ RLK GD A+EIE+ +K+IVAGGDG AGW Sbjct: 64 LLNKYQVFDLGDEAPDSVLRRLYLNIERLKGNGDHFAAEIEERMKIIVAGGDGTAGW 120 >ref|NP_001234476.1| calmodulin-binding diacylglycerol kinase [Solanum lycopersicum] gi|10798890|gb|AAG23128.1|AF198258_1 calmodulin-binding diacylglycerol kinase [Solanum lycopersicum] Length = 511 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = +3 Query: 75 LTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMAGW 245 L N + L +E P+SVLRR++LN+ RLK GD A+EIE+ +K+IVAGGDG AGW Sbjct: 64 LLNKYQVFDLGDEAPDSVLRRLYLNIERLKGNGDHFAAEIEERMKIIVAGGDGTAGW 120 >ref|XP_006652876.1| PREDICTED: diacylglycerol kinase 5-like [Oryza brachyantha] Length = 499 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/62 (51%), Positives = 42/62 (67%) Frame = +3 Query: 60 KLYIPLTN*SYILLLREETPESVLRRVFLNLGRLKNQGDEIASEIEKNLKLIVAGGDGMA 239 K Y L N S + L EE P+ VLRR++ N +LK+ GD +A +I+ NL+LIVAGGDG A Sbjct: 64 KTYRQLLNESQVFDLSEEAPDKVLRRLYCNFEKLKSNGDNLAFQIQSNLRLIVAGGDGTA 123 Query: 240 GW 245 W Sbjct: 124 SW 125