BLASTX nr result
ID: Mentha27_contig00049998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00049998 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45342.1| hypothetical protein MIMGU_mgv1a008567mg [Mimulus... 52 8e-12 >gb|EYU45342.1| hypothetical protein MIMGU_mgv1a008567mg [Mimulus guttatus] Length = 369 Score = 51.6 bits (122), Expect(2) = 8e-12 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 5/57 (8%) Frame = -3 Query: 165 GASLSVKYWKSPHYKIVCVRAKSKRLSSSQI-----FCGIEVYDSQTRTWRLCLESF 10 G +L+ KSP+Y IVCVRA KR S + +C IEVY+S T TW+LC E F Sbjct: 145 GLNLAFDPLKSPYYHIVCVRATRKRRPPSFLRGWYRYCQIEVYESGTDTWQLCGEPF 201 Score = 43.9 bits (102), Expect(2) = 8e-12 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = -1 Query: 251 PVEYC-VYNPTTKQSRKISLPESNKFPIVMGLALA 150 P+EYC +YNPTTKQS+KI L +F V+GL LA Sbjct: 115 PLEYCHIYNPTTKQSKKIPLNTHERFTFVIGLNLA 149