BLASTX nr result
ID: Mentha27_contig00049983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00049983 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509879.1| hydrolase, hydrolyzing O-glycosyl compounds,... 56 6e-06 >ref|XP_002509879.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223549778|gb|EEF51266.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Length = 542 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/50 (50%), Positives = 31/50 (62%) Frame = -1 Query: 334 EHGNYLCLELDPNNLSRVLTNNCFCAERVASMNCLESPHTQWFKLISGNV 185 EHG YLCLE + N S+V T C C E +C E+P +QWFKLI N+ Sbjct: 488 EHGEYLCLEKESFNSSKVFTRKCICIE--DDSDCQENPQSQWFKLIKTNI 535