BLASTX nr result
ID: Mentha27_contig00049950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00049950 (248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17648.1| hypothetical protein MIMGU_mgv1a018535mg, partial... 64 2e-08 ref|XP_004308736.1| PREDICTED: probable replication factor C sub... 55 8e-06 >gb|EYU17648.1| hypothetical protein MIMGU_mgv1a018535mg, partial [Mimulus guttatus] Length = 600 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 99 QGEAVSSILVNLMVSPQHVEVNLSELKGYEKHVIV 203 +GEAV SI VNL+VSPQHVEVNLSELKGYEKH+IV Sbjct: 355 KGEAVGSIFVNLLVSPQHVEVNLSELKGYEKHIIV 389 >ref|XP_004308736.1| PREDICTED: probable replication factor C subunit 3-like [Fragaria vesca subsp. vesca] Length = 623 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 99 QGEAVSSILVNLMVSPQHVEVNLSELKGYEKHVIV 203 +GE V SI V++ SPQHVEVNLSELKGYEKHVIV Sbjct: 313 KGEVVGSIEVHVKQSPQHVEVNLSELKGYEKHVIV 347