BLASTX nr result
ID: Mentha27_contig00049938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00049938 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45184.1| hypothetical protein MIMGU_mgv1a0003262mg, partia... 76 4e-12 gb|EPS69788.1| hypothetical protein M569_04979, partial [Genlise... 57 3e-06 >gb|EYU45184.1| hypothetical protein MIMGU_mgv1a0003262mg, partial [Mimulus guttatus] Length = 96 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 138 FSSSFSFKNPYGDVMLSNGGERKSLQLHEYSEIFSGSSSIPVLDLS 1 FSS+FSFKNPY V+L +GGERKSL+ HEY EIFSGSS+IPVLDLS Sbjct: 20 FSSTFSFKNPYDGVLLPSGGERKSLEAHEYREIFSGSSAIPVLDLS 65 >gb|EPS69788.1| hypothetical protein M569_04979, partial [Genlisea aurea] Length = 73 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 3/48 (6%) Frame = -2 Query: 135 SSSFSFKNPYGDVMLSNGGER---KSLQLHEYSEIFSGSSSIPVLDLS 1 S+ S+KNPY DV+LSNGG R K + +Y+EIF+GSSSIPV DLS Sbjct: 16 SNGISWKNPYEDVVLSNGGGRGKGKVFEARDYAEIFAGSSSIPVFDLS 63