BLASTX nr result
ID: Mentha27_contig00049889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00049889 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41913.1| hypothetical protein MIMGU_mgv11b024393mg [Mimulu... 65 1e-08 gb|EYU41842.1| hypothetical protein MIMGU_mgv1a020578mg [Mimulus... 65 1e-08 gb|EYU20978.1| hypothetical protein MIMGU_mgv1a022212mg, partial... 63 5e-08 gb|EYU41783.1| hypothetical protein MIMGU_mgv1a010050mg [Mimulus... 62 8e-08 gb|EYU41900.1| hypothetical protein MIMGU_mgv11b022084mg, partia... 62 1e-07 gb|EYU36072.1| hypothetical protein MIMGU_mgv1a019763mg, partial... 62 1e-07 gb|EYU18113.1| hypothetical protein MIMGU_mgv1a024785mg, partial... 61 2e-07 gb|EYU29777.1| hypothetical protein MIMGU_mgv1a008457mg [Mimulus... 60 2e-07 gb|EYU41852.1| hypothetical protein MIMGU_mgv1a020064mg, partial... 60 4e-07 gb|EYU41072.1| hypothetical protein MIMGU_mgv1a023916mg, partial... 60 4e-07 gb|EYU41070.1| hypothetical protein MIMGU_mgv1a017941mg, partial... 60 4e-07 gb|EYU27335.1| hypothetical protein MIMGU_mgv1a017041mg [Mimulus... 59 5e-07 gb|EYU35246.1| hypothetical protein MIMGU_mgv1a006037mg [Mimulus... 59 7e-07 gb|EYU23721.1| hypothetical protein MIMGU_mgv1a019171mg, partial... 59 7e-07 gb|EYU27057.1| hypothetical protein MIMGU_mgv1a009397mg [Mimulus... 58 1e-06 gb|EYU25811.1| hypothetical protein MIMGU_mgv11b018114mg [Mimulu... 58 1e-06 gb|EYU38949.1| hypothetical protein MIMGU_mgv1a024102mg [Mimulus... 58 2e-06 gb|EYU41914.1| hypothetical protein MIMGU_mgv1a020661mg, partial... 57 2e-06 gb|EYU35151.1| hypothetical protein MIMGU_mgv1a025644mg, partial... 57 3e-06 gb|EYU25809.1| hypothetical protein MIMGU_mgv1a021367mg, partial... 57 3e-06 >gb|EYU41913.1| hypothetical protein MIMGU_mgv11b024393mg [Mimulus guttatus] Length = 464 Score = 64.7 bits (156), Expect = 1e-08 Identities = 40/95 (42%), Positives = 53/95 (55%), Gaps = 2/95 (2%) Frame = +2 Query: 23 PNYMVVLEDLL--RESGLCRPQNLILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALSI 196 PN+ E+L RE L P+ L F LK+LS VS ++L L +CP LE L + Sbjct: 156 PNFYCFPEELFTPREPKLQHPRMLFDFTSLKELSFKSIIVSDRAIELFLHNCPLLEQLIV 215 Query: 197 GSAVFTSDVEVCGSSLLLKRLEVYFHKGNRSLKVS 301 + S +EVCG SL+LK LE+ G +SLKVS Sbjct: 216 HYSQKISKLEVCGPSLMLKHLEIVHCTGLKSLKVS 250 >gb|EYU41842.1| hypothetical protein MIMGU_mgv1a020578mg [Mimulus guttatus] Length = 532 Score = 64.7 bits (156), Expect = 1e-08 Identities = 40/89 (44%), Positives = 53/89 (59%), Gaps = 3/89 (3%) Frame = +2 Query: 44 EDLLRESG---LCRPQNLILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFT 214 E L R SG + P + I F+ LK LS+ VSGE ++ LR+CP LE L + +A Sbjct: 360 ELLTRTSGGASILEPASCIDFKSLKALSMRFVNVSGEAIEFFLRTCPFLEKLVVHNASEL 419 Query: 215 SDVEVCGSSLLLKRLEVYFHKGNRSLKVS 301 S++EVCGSSL LK LE+ S+KVS Sbjct: 420 SNLEVCGSSLDLKHLELQSCHNLTSIKVS 448 >gb|EYU20978.1| hypothetical protein MIMGU_mgv1a022212mg, partial [Mimulus guttatus] Length = 241 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/69 (44%), Positives = 46/69 (66%) Frame = +2 Query: 95 FRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLKRLEVYFH 274 F+PLK L+L + V G ++ LR+CP LE L + + S VEVCGSSL+LKRLE+ + Sbjct: 108 FKPLKALTLEYIDVDGGAIEFFLRNCPLLEELIVHESKELSIVEVCGSSLVLKRLEICYC 167 Query: 275 KGNRSLKVS 301 + + ++VS Sbjct: 168 RNLKLVRVS 176 >gb|EYU41783.1| hypothetical protein MIMGU_mgv1a010050mg [Mimulus guttatus] Length = 324 Score = 62.0 bits (149), Expect = 8e-08 Identities = 37/94 (39%), Positives = 56/94 (59%) Frame = +2 Query: 20 DPNYMVVLEDLLRESGLCRPQNLILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIG 199 + +Y + E L R SG + I F+ LK+LSL V+G+ ++++LR CP LE L + Sbjct: 129 ETHYTLREEFLTRISG---GNSCIGFKSLKELSLKCLNVTGQAIEILLRMCPLLEKLVVH 185 Query: 200 SAVFTSDVEVCGSSLLLKRLEVYFHKGNRSLKVS 301 S++EVCG SL+LK E+ + G S+KVS Sbjct: 186 RTTKISNLEVCGPSLVLKHFELVYCFGLESVKVS 219 >gb|EYU41900.1| hypothetical protein MIMGU_mgv11b022084mg, partial [Mimulus guttatus] Length = 448 Score = 61.6 bits (148), Expect = 1e-07 Identities = 37/96 (38%), Positives = 55/96 (57%), Gaps = 3/96 (3%) Frame = +2 Query: 23 PNYMVVLEDLLRES-GLC--RPQNLILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALS 193 PN +++ L S +C P+ L+ F+ LK+LS +V ++ L +CP LE L Sbjct: 145 PNELLIASKLQPPSDSVCIDHPRMLVDFKSLKELSFRSVQVGDAAIEFFLHNCPLLEKLI 204 Query: 194 IGSAVFTSDVEVCGSSLLLKRLEVYFHKGNRSLKVS 301 + + S +EVCGSSL LK LE+ + G +SLKVS Sbjct: 205 VHHSEKISKLEVCGSSLKLKHLEIVYCFGLKSLKVS 240 >gb|EYU36072.1| hypothetical protein MIMGU_mgv1a019763mg, partial [Mimulus guttatus] Length = 357 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/69 (46%), Positives = 46/69 (66%) Frame = +2 Query: 95 FRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLKRLEVYFH 274 F+ LK LSL K+SGE ++ LR+CP LE L + + S++EVCG SL LK LE++F Sbjct: 178 FKSLKALSLKCVKLSGEAIEFFLRNCPFLEKLVLRNVNGISNLEVCGPSLALKHLEIWFC 237 Query: 275 KGNRSLKVS 301 +S++VS Sbjct: 238 AKLKSVRVS 246 >gb|EYU18113.1| hypothetical protein MIMGU_mgv1a024785mg, partial [Mimulus guttatus] Length = 409 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/77 (44%), Positives = 46/77 (59%), Gaps = 1/77 (1%) Frame = +2 Query: 74 RPQNLILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIG-SAVFTSDVEVCGSSLLL 250 R L F+ LK LS VSG ++ +LR+CP LE L + S TS +EVCGSSL+L Sbjct: 121 RSSTLSEFKSLKSLSFKGVNVSGRAIEFLLRNCPRLEQLIVSHSQDKTSKIEVCGSSLVL 180 Query: 251 KRLEVYFHKGNRSLKVS 301 K L++ + SLK+S Sbjct: 181 KHLKIAYCSALESLKIS 197 >gb|EYU29777.1| hypothetical protein MIMGU_mgv1a008457mg [Mimulus guttatus] Length = 373 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/69 (43%), Positives = 46/69 (66%) Frame = +2 Query: 95 FRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLKRLEVYFH 274 F+PLK L+L V+ E ++ L +CP LE L + + S+VEVCGSSL+LKRLE+ + Sbjct: 98 FKPLKALTLKFIDVNDEAIEFFLLNCPLLEELIVHESKELSNVEVCGSSLVLKRLEICYC 157 Query: 275 KGNRSLKVS 301 + + ++VS Sbjct: 158 RNLKLVRVS 166 >gb|EYU41852.1| hypothetical protein MIMGU_mgv1a020064mg, partial [Mimulus guttatus] Length = 367 Score = 59.7 bits (143), Expect = 4e-07 Identities = 38/96 (39%), Positives = 54/96 (56%) Frame = +2 Query: 14 CDDPNYMVVLEDLLRESGLCRPQNLILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALS 193 C+D +Y + L S + I F+ LK LSL V+GE ++ LR+CPSLE L Sbjct: 154 CEDTHYNFPEKFLKHPS----QSSSINFKSLKALSLKCVNVTGEAIEFFLRNCPSLEKLV 209 Query: 194 IGSAVFTSDVEVCGSSLLLKRLEVYFHKGNRSLKVS 301 + S++EVCG SL LK L++ F +S+KVS Sbjct: 210 VTYTSKLSNLEVCGPSLALKHLDLRFCFRLKSVKVS 245 >gb|EYU41072.1| hypothetical protein MIMGU_mgv1a023916mg, partial [Mimulus guttatus] Length = 252 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 1/73 (1%) Frame = +2 Query: 83 NLIL-FRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLKRL 259 N++L F+ LK+LSL + G ++L LR+CP LE L + + S +EVCG SL+LK L Sbjct: 152 NMVLGFKSLKELSLKKVNLRGGDIELFLRNCPLLEQLIVHTTWTVSKIEVCGPSLVLKHL 211 Query: 260 EVYFHKGNRSLKV 298 E+ G SLKV Sbjct: 212 EIVKCTGLESLKV 224 >gb|EYU41070.1| hypothetical protein MIMGU_mgv1a017941mg, partial [Mimulus guttatus] Length = 265 Score = 59.7 bits (143), Expect = 4e-07 Identities = 38/102 (37%), Positives = 56/102 (54%), Gaps = 2/102 (1%) Frame = +2 Query: 2 LDFICDDPNYMVVLE-DLLRESGLCRPQNLILFRPLKQLSLHHFKVSGETVKLILRSCPS 178 L+ DDP++ L E L R ++ F LK+LSL + ++SG ++ + +C Sbjct: 139 LELHLDDPDFRSYGSCSCLPEQLLARSNMILNFNSLKELSLKNVQLSGGAIEFFIHNCTR 198 Query: 179 LEALSIGS-AVFTSDVEVCGSSLLLKRLEVYFHKGNRSLKVS 301 LE L + S S +EVCGSSL+LK LE+ G SLK+S Sbjct: 199 LEKLIVDSPGENVSKLEVCGSSLVLKHLEIVSFVGLESLKIS 240 >gb|EYU27335.1| hypothetical protein MIMGU_mgv1a017041mg [Mimulus guttatus] Length = 96 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/75 (42%), Positives = 46/75 (61%) Frame = +2 Query: 77 PQNLILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLKR 256 P+ L F+ LK LSL +VS ++ L +CP LE L + ++ S +E+CGSSL LK Sbjct: 14 PRMLFDFKSLKALSLKSVRVSDGAIEFFLHNCPLLEQLIVHESIKLSRLEICGSSLKLKH 73 Query: 257 LEVYFHKGNRSLKVS 301 LE+ + +SLKVS Sbjct: 74 LEIVSCRRLKSLKVS 88 >gb|EYU35246.1| hypothetical protein MIMGU_mgv1a006037mg [Mimulus guttatus] Length = 460 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/69 (47%), Positives = 45/69 (65%) Frame = +2 Query: 95 FRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLKRLEVYFH 274 F+ LK LSL+ VS E ++ LR+CP LE L++ + S++EV GSSL+LK LE+ Sbjct: 179 FKSLKALSLNRVNVSSEAIEFFLRNCPLLEQLTVHNEKELSNLEVWGSSLVLKHLEITDC 238 Query: 275 KGNRSLKVS 301 RSLKVS Sbjct: 239 DKLRSLKVS 247 >gb|EYU23721.1| hypothetical protein MIMGU_mgv1a019171mg, partial [Mimulus guttatus] Length = 442 Score = 58.9 bits (141), Expect = 7e-07 Identities = 39/95 (41%), Positives = 53/95 (55%) Frame = +2 Query: 17 DDPNYMVVLEDLLRESGLCRPQNLILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALSI 196 DD Y+ + L R S + + FR LK+LSL V+ E V+ L +CP LE L + Sbjct: 141 DDTCYVFPNKFLKRPS----QSSSVNFRSLKELSLKSVIVTREAVEFFLHNCPLLEKLVV 196 Query: 197 GSAVFTSDVEVCGSSLLLKRLEVYFHKGNRSLKVS 301 S++EVCGSSL LK LE+ G +S+KVS Sbjct: 197 SYTCQLSNLEVCGSSLALKHLELKHCYGLKSVKVS 231 >gb|EYU27057.1| hypothetical protein MIMGU_mgv1a009397mg [Mimulus guttatus] Length = 343 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/59 (45%), Positives = 39/59 (66%) Frame = +2 Query: 95 FRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLKRLEVYF 271 F PLK L+L + V G ++ LR+CP LE L++ + SDV VCG+SL+LK LE+ + Sbjct: 179 FTPLKALTLKYIDVDGGAIEFFLRNCPLLEELTVHESKELSDVSVCGTSLVLKHLEICY 237 >gb|EYU25811.1| hypothetical protein MIMGU_mgv11b018114mg [Mimulus guttatus] Length = 421 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/75 (42%), Positives = 45/75 (60%) Frame = +2 Query: 74 RPQNLILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLK 253 R ++ F+ LK LSL + G ++L LR+CP LE L + +A +EVCG SL+LK Sbjct: 130 RSNTVLEFKSLKALSLKRVTLRGGEIELFLRNCPLLEQLIVHTAWNIPTIEVCGPSLVLK 189 Query: 254 RLEVYFHKGNRSLKV 298 LE+ G +SLKV Sbjct: 190 HLEIVNCTGLQSLKV 204 >gb|EYU38949.1| hypothetical protein MIMGU_mgv1a024102mg [Mimulus guttatus] Length = 469 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/71 (46%), Positives = 44/71 (61%) Frame = +2 Query: 89 ILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLKRLEVY 268 I FR LK+L VSGE ++ LR CP LE L + +A S++EVCGSSL LK L++ Sbjct: 197 INFRSLKELCFKCVTVSGEAIEFFLRKCPLLEKLVVQNASQISNLEVCGSSLALKHLKLK 256 Query: 269 FHKGNRSLKVS 301 +S+KVS Sbjct: 257 SCYDLKSVKVS 267 >gb|EYU41914.1| hypothetical protein MIMGU_mgv1a020661mg, partial [Mimulus guttatus] Length = 222 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/71 (43%), Positives = 43/71 (60%) Frame = +2 Query: 59 ESGLCRPQNLILFRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGS 238 E L +P+ L F+ LKQLS VS ++L L +CP LE L + + S +EVCG Sbjct: 150 EPKLQQPRMLFDFKSLKQLSFKMIIVSDRAIELFLHNCPLLEQLIVHYSKKISKLEVCGP 209 Query: 239 SLLLKRLEVYF 271 SL+LK LE+Y+ Sbjct: 210 SLMLKHLELYY 220 >gb|EYU35151.1| hypothetical protein MIMGU_mgv1a025644mg, partial [Mimulus guttatus] Length = 340 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/69 (46%), Positives = 43/69 (62%) Frame = +2 Query: 95 FRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLKRLEVYFH 274 F+ LK LS +SG ++ LR+CP LE L + SA S +EVCGSSL+LK LE+ Sbjct: 152 FKSLKALSFKSVDLSGGAIEFFLRNCPLLEQLIVHSARKLSKLEVCGSSLVLKHLEIVRC 211 Query: 275 KGNRSLKVS 301 +SLKV+ Sbjct: 212 PFLKSLKVA 220 >gb|EYU25809.1| hypothetical protein MIMGU_mgv1a021367mg, partial [Mimulus guttatus] Length = 212 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +2 Query: 95 FRPLKQLSLHHFKVSGETVKLILRSCPSLEALSIGSAVFTSDVEVCGSSLLLKRLEV 265 F+ LK+L H VSG +++ LR+CP LE L++ S S +EVCGSSL+LK LE+ Sbjct: 156 FKRLKELFFKHVNVSGGSIESFLRNCPLLEKLTVHSLGKLSKLEVCGSSLVLKHLEI 212