BLASTX nr result
ID: Mentha27_contig00049776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00049776 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17650.1| hypothetical protein MIMGU_mgv11b020521mg, partia... 61 1e-07 >gb|EYU17650.1| hypothetical protein MIMGU_mgv11b020521mg, partial [Mimulus guttatus] Length = 445 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/64 (51%), Positives = 38/64 (59%) Frame = -1 Query: 332 VKKKG*GADSGNERRSLEQPCDIRVNLTFGGVRYVHYYYGCYDPLQYCLIFPYGEPGWYA 153 V K G + +G ER DIRV G R + YYYGCYD LQY L+F GEPGW+A Sbjct: 365 VWKDGDRSGTGLER-------DIRVFTKSGASRIISYYYGCYDTLQYPLLFTRGEPGWHA 417 Query: 152 GIPK 141 GI K Sbjct: 418 GIGK 421