BLASTX nr result
ID: Mentha27_contig00049259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00049259 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64321.1| hypothetical protein M569_10459 [Genlisea aurea] 58 1e-06 >gb|EPS64321.1| hypothetical protein M569_10459 [Genlisea aurea] Length = 765 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = +3 Query: 93 MDKSIVAVEESQWRNDSPASASKSLGSLVRINSIAIDLSCAMEEIESPLHEHFSIR 260 M+KSIVAV +S AS SKSL V+I+SIAID++C M EI+ P H+HFSIR Sbjct: 1 MEKSIVAVGQS-------ASGSKSLVPFVQIDSIAIDINCPMREIQPPQHDHFSIR 49