BLASTX nr result
ID: Mentha27_contig00049255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00049255 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34657.1| hypothetical protein MIMGU_mgv1a020708mg [Mimulus... 60 3e-07 >gb|EYU34657.1| hypothetical protein MIMGU_mgv1a020708mg [Mimulus guttatus] Length = 522 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/59 (52%), Positives = 39/59 (66%) Frame = +3 Query: 3 QCWLFWEALDHQYHKVESYLSLECDDNNNGNGKIVLFHHHISGKFQELEILLERFVEDQ 179 Q LFWE L+HQY K+ GN +I LFHH ++GKFQEL+ILLER+VE+Q Sbjct: 288 QLCLFWEGLNHQYLKLL------------GNCEIKLFHHSVAGKFQELQILLERYVENQ 334