BLASTX nr result
ID: Mentha27_contig00048419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00048419 (234 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25855.1| hypothetical protein MIMGU_mgv11b019386mg, partia... 75 7e-12 emb|CAN83285.1| hypothetical protein VITISV_004139 [Vitis vinifera] 62 6e-08 emb|CAN60203.1| hypothetical protein VITISV_036059 [Vitis vinifera] 62 6e-08 ref|XP_002270154.1| PREDICTED: uncharacterized protein LOC100264... 58 1e-06 ref|XP_006369958.1| hypothetical protein POPTR_0001s36275g [Popu... 56 6e-06 >gb|EYU25855.1| hypothetical protein MIMGU_mgv11b019386mg, partial [Mimulus guttatus] Length = 135 Score = 75.5 bits (184), Expect = 7e-12 Identities = 40/67 (59%), Positives = 48/67 (71%), Gaps = 3/67 (4%) Frame = +2 Query: 2 ESQGLLEFIDSGEA---PKDGVDYVAWRRTDRLVKGWILGALSNEALQKVVHLDSARDVW 172 E+Q LL +I +GE P Y WRR DRLVKGWILGALS+E ++ V+L+SARDVW Sbjct: 56 ETQDLLGYI-AGEISPPPMTSESYAVWRRRDRLVKGWILGALSDEVVETAVNLNSARDVW 114 Query: 173 LDLEKAF 193 L LEKAF Sbjct: 115 LHLEKAF 121 >emb|CAN83285.1| hypothetical protein VITISV_004139 [Vitis vinifera] Length = 1556 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = +2 Query: 41 APKDGVDYVAWRRTDRLVKGWILGALSNEALQKVVHLDSARDVWLDLEKAFPTDQSQQ 214 AP+ Y+AWR+ DRL++GWI+G LS E L V LD+A DVW L+ A+ D ++ Sbjct: 326 APRKTEAYIAWRKADRLLRGWIIGTLSEETLGLAVGLDTANDVWEALKNAYAEDSQER 383 >emb|CAN60203.1| hypothetical protein VITISV_036059 [Vitis vinifera] Length = 1412 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = +2 Query: 41 APKDGVDYVAWRRTDRLVKGWILGALSNEALQKVVHLDSARDVWLDLEKAFPTDQSQQ 214 AP+ Y+AWR+ DRL++GWI+G LS E L V LD+A DVW L+ A+ D ++ Sbjct: 66 APRKTEAYIAWRKADRLLRGWIIGTLSEETLGLAVGLDTANDVWEALKNAYAEDSQER 123 >ref|XP_002270154.1| PREDICTED: uncharacterized protein LOC100264911 [Vitis vinifera] Length = 1946 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/58 (41%), Positives = 36/58 (62%) Frame = +2 Query: 41 APKDGVDYVAWRRTDRLVKGWILGALSNEALQKVVHLDSARDVWLDLEKAFPTDQSQQ 214 AP+ Y+ WR+ DRL++GWI+G LS E L + LD+ DVW L+ A+ D ++ Sbjct: 170 APRKTEAYITWRKADRLLRGWIIGTLSEETLGLAMGLDTTNDVWEALKNAYAEDSQER 227 >ref|XP_006369958.1| hypothetical protein POPTR_0001s36275g [Populus trichocarpa] gi|550349005|gb|ERP66527.1| hypothetical protein POPTR_0001s36275g [Populus trichocarpa] Length = 277 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Frame = +2 Query: 26 IDSGEA--PKDGVDYVAWRRTDRLVKGWILGALSNEALQKVVHLDSARDVWLDLEKAFPT 199 I SGE PK ++AWR+ DRL++ WI+G LS E L VV LD+A VW + A+ Sbjct: 59 ITSGEKLEPKLTETFIAWRKADRLLRWWIIGTLSEETLSLVVGLDTAHAVWEAFKNAYAQ 118 Query: 200 DQSQQ 214 D ++ Sbjct: 119 DSQER 123