BLASTX nr result
ID: Mentha27_contig00048259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00048259 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44044.1| hypothetical protein MIMGU_mgv1a017183mg [Mimulus... 62 1e-07 gb|EYU38411.1| hypothetical protein MIMGU_mgv1a021572mg [Mimulus... 57 3e-06 >gb|EYU44044.1| hypothetical protein MIMGU_mgv1a017183mg [Mimulus guttatus] Length = 89 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/56 (53%), Positives = 36/56 (64%), Gaps = 6/56 (10%) Frame = -3 Query: 190 MPQWRSTFRWVDSGFPIPASFFRWPRLFSSYLTPPS-WSWSSGV-----GLNLRLP 41 M QW S FRW+++ + AS FRWP LF SYLTPP WSWSS + +LRLP Sbjct: 1 MAQWTSAFRWLEASISLSASLFRWPPLFVSYLTPPPIWSWSSTLDPGRWAPHLRLP 56 >gb|EYU38411.1| hypothetical protein MIMGU_mgv1a021572mg [Mimulus guttatus] Length = 99 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 166 RWVDSGFPIPASFFRWPRLFSSYLTPPSWSWSSGVGLNL 50 RW+D F +P SFFRWPRLF+SYLTPP WSS + L L Sbjct: 14 RWLDVSFSLPTSFFRWPRLFTSYLTPPP-RWSSSLSLAL 51