BLASTX nr result
ID: Mentha27_contig00047930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047930 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB62771.1| hypothetical protein L484_000343 [Morus notabilis] 56 5e-06 >gb|EXB62771.1| hypothetical protein L484_000343 [Morus notabilis] Length = 82 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = +1 Query: 232 ILKRLDRMEAQQKALCKYMQQRDIALRKSLQRNFTKPTEPFPQFP*MVFE 381 +++ + RM QQ+ Y +QRD AL+KSLQ+NFTKP PFP+FP V E Sbjct: 15 MMELMQRMHKQQQQYWAYAEQRDNALKKSLQKNFTKPVFPFPEFPEEVLE 64