BLASTX nr result
ID: Mentha27_contig00047851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047851 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60256.1| hypothetical protein M569_14548, partial [Genlise... 63 5e-08 >gb|EPS60256.1| hypothetical protein M569_14548, partial [Genlisea aurea] Length = 396 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 7/53 (13%) Frame = +3 Query: 3 MKVWRVKVYPSEKVCGSEKDEGEGDC-------RMSPVLSPLWVERKIQGSDY 140 +K+WRVKVYP E +K++ GDC +MSPVLSP WVERKIQGSDY Sbjct: 346 LKLWRVKVYPGENA--EKKEDHNGDCFFAMEAAKMSPVLSPSWVERKIQGSDY 396