BLASTX nr result
ID: Mentha27_contig00047840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047840 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18641.1| hypothetical protein MIMGU_mgv1a019560mg, partial... 56 4e-06 >gb|EYU18641.1| hypothetical protein MIMGU_mgv1a019560mg, partial [Mimulus guttatus] Length = 352 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -3 Query: 154 SSYSAEIVGSNEDLLSQIFSKLKKEKLAPLACVCKNWYRLITGHKYVYKIP 2 +SYSAE +GSN+DL++ IF+KL+ + A +CK WY +IT + YK+P Sbjct: 47 TSYSAESIGSNQDLINLIFTKLEPKHRQRCAIICKFWYSVITSRTFKYKLP 97