BLASTX nr result
ID: Mentha27_contig00047794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047794 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007047735.1| Dof-type zinc finger DNA-binding family prot... 60 3e-07 >ref|XP_007047735.1| Dof-type zinc finger DNA-binding family protein [Theobroma cacao] gi|508699996|gb|EOX91892.1| Dof-type zinc finger DNA-binding family protein [Theobroma cacao] Length = 323 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 117 KPAGKDESQSSSSRKATSGRAQEPPVKCPRCDSPNTKF 4 KPA K+E+QS S+RKA S R QE +KCPRCDSPNTKF Sbjct: 10 KPATKEENQSGSNRKAASTRPQEQALKCPRCDSPNTKF 47