BLASTX nr result
ID: Mentha27_contig00047572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047572 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007223836.1| hypothetical protein PRUPE_ppa014082mg [Prun... 57 2e-06 ref|XP_007199235.1| hypothetical protein PRUPE_ppa022154mg, part... 55 8e-06 >ref|XP_007223836.1| hypothetical protein PRUPE_ppa014082mg [Prunus persica] gi|462420772|gb|EMJ25035.1| hypothetical protein PRUPE_ppa014082mg [Prunus persica] Length = 88 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -2 Query: 252 VRLNTEGGGPIKVACYLGLRASPLCCTTAWAWRTPSKPV 136 ++L + GGGP VACY G +ASP CTTAWAWRTP K V Sbjct: 41 IKLISLGGGPTTVACYWGSQASPKRCTTAWAWRTPPKQV 79 >ref|XP_007199235.1| hypothetical protein PRUPE_ppa022154mg, partial [Prunus persica] gi|462394635|gb|EMJ00434.1| hypothetical protein PRUPE_ppa022154mg, partial [Prunus persica] Length = 95 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -2 Query: 252 VRLNTEGGGPIKVACYLGLRASPLCCTTAWAWRTP 148 ++L + GGG VACY G RASP CCT AWAWRTP Sbjct: 13 IKLISFGGGSATVACYWGSRASPKCCTIAWAWRTP 47