BLASTX nr result
ID: Mentha27_contig00047465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047465 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19820.1| hypothetical protein MIMGU_mgv11b018162mg [Mimulu... 57 3e-06 >gb|EYU19820.1| hypothetical protein MIMGU_mgv11b018162mg [Mimulus guttatus] Length = 260 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +1 Query: 112 GVDSVAIDTENNLVYIAGKIDATTLVTKVAKLGKAVQLLPEEK 240 GVDSV+IDTE LV++ GKID TTL+ +V+ LGK V+LLP + Sbjct: 74 GVDSVSIDTEKGLVFVTGKIDPTTLLDRVSNLGKEVRLLPNNQ 116