BLASTX nr result
ID: Mentha27_contig00047452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047452 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23296.1| hypothetical protein MIMGU_mgv1a021531mg, partial... 62 6e-08 gb|EYU23299.1| hypothetical protein MIMGU_mgv1a019474mg, partial... 58 2e-06 >gb|EYU23296.1| hypothetical protein MIMGU_mgv1a021531mg, partial [Mimulus guttatus] Length = 325 Score = 62.4 bits (150), Expect = 6e-08 Identities = 38/88 (43%), Positives = 51/88 (57%), Gaps = 7/88 (7%) Frame = -2 Query: 243 EGGMEISKSSYPSGFH--ILTSCNGLVLGIDTGDGESVPCIVNPATRTRFYLPQLP---- 82 EG +E+SK Y G + +SCNGL+L D+ +++ + NPAT+ RFYLPQ P Sbjct: 99 EGRVEVSKLRYKFGIESTVWSSCNGLILDFDSKKRKALYTL-NPATKRRFYLPQFPSQWE 157 Query: 81 -HTLFGCRAVMKYFGLAYVAASMEYKVV 1 H + Y G+AY ASMEYKVV Sbjct: 158 DHNYY-------YSGIAYAEASMEYKVV 178 >gb|EYU23299.1| hypothetical protein MIMGU_mgv1a019474mg, partial [Mimulus guttatus] Length = 228 Score = 57.8 bits (138), Expect = 2e-06 Identities = 39/85 (45%), Positives = 45/85 (52%), Gaps = 4/85 (4%) Frame = -2 Query: 243 EGGMEISKSSYPSGFHILTS----CNGLVLGIDTGDGESVPCIVNPATRTRFYLPQLPHT 76 EG +EISK SY GF S C+GL+L +D G C VNPAT R LP P Sbjct: 100 EGRVEISKMSY--GFKGSVSAGSGCSGLILEVDVGKKSKRVCAVNPATGRRLALP--PFV 155 Query: 75 LFGCRAVMKYFGLAYVAASMEYKVV 1 FG+AYVAAS+EYK V Sbjct: 156 YHNWSENYDCFGVAYVAASVEYKAV 180