BLASTX nr result
ID: Mentha27_contig00047352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047352 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC28024.1| 50S ribosomal protein L2 [Morus notabilis] 73 5e-11 gb|EXB89255.1| hypothetical protein L484_006809 [Morus notabilis] 73 5e-11 ref|YP_008592707.1| ribosomal protein L2 (chloroplast) [Berberis... 68 1e-09 ref|XP_002515004.1| 50S ribosomal protein L2, putative [Ricinus ... 67 2e-09 ref|XP_004309313.1| PREDICTED: 50S ribosomal protein L2, chlorop... 66 4e-09 ref|XP_003605596.1| 50S ribosomal protein L2-B [Medicago truncat... 66 4e-09 ref|XP_004228574.1| PREDICTED: LOW QUALITY PROTEIN: 50S ribosoma... 64 2e-08 gb|AFS35548.1| ribosomal protein L2, partial [Fragaria pentaphylla] 62 6e-08 ref|XP_003606061.1| 50S ribosomal protein L2-B [Medicago truncat... 62 6e-08 >gb|EXC28024.1| 50S ribosomal protein L2 [Morus notabilis] Length = 200 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 103 SSTSRKPYALEEACTVWEGVLIDQKEESTSTDMP 2 SSTSRKPYALEEACTVWEGVLIDQKEESTSTDMP Sbjct: 27 SSTSRKPYALEEACTVWEGVLIDQKEESTSTDMP 60 >gb|EXB89255.1| hypothetical protein L484_006809 [Morus notabilis] Length = 97 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 103 SSTSRKPYALEEACTVWEGVLIDQKEESTSTDMP 2 SSTSRKPYALEEACTVWEGVLIDQKEESTSTDMP Sbjct: 27 SSTSRKPYALEEACTVWEGVLIDQKEESTSTDMP 60 >ref|YP_008592707.1| ribosomal protein L2 (chloroplast) [Berberis bealei] gi|536462748|gb|AGU37113.1| ribosomal protein L2 (chloroplast) [Berberis bealei] Length = 310 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 103 SSTSRKPYALEEACTVWEGVLIDQKEESTSTDMP 2 S TS KPYALEEACTVWEGVLIDQKEESTSTDMP Sbjct: 137 SYTSGKPYALEEACTVWEGVLIDQKEESTSTDMP 170 >ref|XP_002515004.1| 50S ribosomal protein L2, putative [Ricinus communis] gi|223546055|gb|EEF47558.1| 50S ribosomal protein L2, putative [Ricinus communis] Length = 111 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 103 SSTSRKPYALEEACTVWEGVLIDQKEESTSTDMP 2 SST RKPYALEEACTVWE +LIDQKEESTSTDMP Sbjct: 7 SSTPRKPYALEEACTVWEEILIDQKEESTSTDMP 40 >ref|XP_004309313.1| PREDICTED: 50S ribosomal protein L2, chloroplastic-like, partial [Fragaria vesca subsp. vesca] Length = 170 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 91 RKPYALEEACTVWEGVLIDQKEESTSTDMP 2 RKPYALEEACTVWEGVLIDQKEESTSTDMP Sbjct: 1 RKPYALEEACTVWEGVLIDQKEESTSTDMP 30 >ref|XP_003605596.1| 50S ribosomal protein L2-B [Medicago truncatula] gi|355506651|gb|AES87793.1| 50S ribosomal protein L2-B [Medicago truncatula] Length = 399 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 91 RKPYALEEACTVWEGVLIDQKEESTSTDMP 2 RKPYALEEACTVWEGVLIDQKEESTSTDMP Sbjct: 170 RKPYALEEACTVWEGVLIDQKEESTSTDMP 199 >ref|XP_004228574.1| PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal protein L2, chloroplastic-like [Solanum lycopersicum] Length = 414 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 91 RKPYALEEACTVWEGVLIDQKEESTSTDMP 2 RKPYALEEACTVWEGVLID KEESTSTDMP Sbjct: 185 RKPYALEEACTVWEGVLIDXKEESTSTDMP 214 >gb|AFS35548.1| ribosomal protein L2, partial [Fragaria pentaphylla] Length = 122 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 85 PYALEEACTVWEGVLIDQKEESTSTDMP 2 PYALEEACTVWEGVLIDQKEESTSTDMP Sbjct: 1 PYALEEACTVWEGVLIDQKEESTSTDMP 28 >ref|XP_003606061.1| 50S ribosomal protein L2-B [Medicago truncatula] gi|355507116|gb|AES88258.1| 50S ribosomal protein L2-B [Medicago truncatula] Length = 382 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 85 PYALEEACTVWEGVLIDQKEESTSTDMP 2 PYALEEACTVWEGVLIDQKEESTSTDMP Sbjct: 235 PYALEEACTVWEGVLIDQKEESTSTDMP 262