BLASTX nr result
ID: Mentha27_contig00047316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047316 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482730.1| PREDICTED: axoneme-associated protein mst101... 60 4e-07 gb|EYU44177.1| hypothetical protein MIMGU_mgv1a005514mg [Mimulus... 59 7e-07 ref|XP_006431273.1| hypothetical protein CICLE_v10011468mg [Citr... 57 2e-06 ref|XP_004306093.1| PREDICTED: uncharacterized protein LOC101304... 57 2e-06 ref|XP_007032694.1| TPX2 protein family, putative [Theobroma cac... 57 3e-06 ref|XP_002882204.1| hypothetical protein ARALYDRAFT_477435 [Arab... 56 5e-06 gb|EYU34610.1| hypothetical protein MIMGU_mgv1a023946mg [Mimulus... 55 8e-06 gb|AAG51320.1|AC067753_1 hypothetical protein; 557-2776 [Arabido... 55 8e-06 ref|NP_186749.2| TPX2 (targeting protein for Xklp2) family prote... 55 8e-06 >ref|XP_006482730.1| PREDICTED: axoneme-associated protein mst101(2)-like [Citrus sinensis] Length = 510 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -1 Query: 291 IPKRSDKHPTIPKDPKFNLPQQKKIKCYLSMDDFTA 184 IP+RS+KHPTIP+DPKF++PQ KKIKC LS +D ++ Sbjct: 470 IPRRSEKHPTIPRDPKFHIPQHKKIKCCLSWNDISS 505 >gb|EYU44177.1| hypothetical protein MIMGU_mgv1a005514mg [Mimulus guttatus] Length = 481 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 291 IPKRSDKHPTIPKDPKFNLPQQKKIKCYLSMDD 193 +PKRS K PT+PK+PKF++PQQKKIKC LS+DD Sbjct: 439 VPKRSMKQPTVPKEPKFHIPQQKKIKCNLSLDD 471 >ref|XP_006431273.1| hypothetical protein CICLE_v10011468mg [Citrus clementina] gi|557533330|gb|ESR44513.1| hypothetical protein CICLE_v10011468mg [Citrus clementina] Length = 528 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -1 Query: 291 IPKRSDKHPTIPKDPKFNLPQQKKIKCYLSMDDFTA 184 IP+R +KHPTIP+DPKF++PQ KKIKC LS +D ++ Sbjct: 488 IPRRLEKHPTIPRDPKFHIPQHKKIKCCLSWNDISS 523 >ref|XP_004306093.1| PREDICTED: uncharacterized protein LOC101304902 [Fragaria vesca subsp. vesca] Length = 492 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 291 IPKRSDKHPTIPKDPKFNLPQQKKIKCYLSMDD 193 IP+RS KHPTIPKDPKF++PQ KKIKC +S +D Sbjct: 449 IPRRSMKHPTIPKDPKFHIPQHKKIKCCMSWND 481 >ref|XP_007032694.1| TPX2 protein family, putative [Theobroma cacao] gi|508711723|gb|EOY03620.1| TPX2 protein family, putative [Theobroma cacao] Length = 507 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/37 (59%), Positives = 31/37 (83%) Frame = -1 Query: 291 IPKRSDKHPTIPKDPKFNLPQQKKIKCYLSMDDFTAH 181 IP+RS KHPTIP++PKF++PQ KKIKC +S +D + + Sbjct: 461 IPRRSSKHPTIPREPKFHIPQHKKIKCCISWNDMSTY 497 >ref|XP_002882204.1| hypothetical protein ARALYDRAFT_477435 [Arabidopsis lyrata subsp. lyrata] gi|297328044|gb|EFH58463.1| hypothetical protein ARALYDRAFT_477435 [Arabidopsis lyrata subsp. lyrata] Length = 479 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/27 (81%), Positives = 27/27 (100%) Frame = -1 Query: 291 IPKRSDKHPTIPKDPKFNLPQQKKIKC 211 IPKRS+KHPTIP+DPKFN+PQ+KKI+C Sbjct: 431 IPKRSNKHPTIPRDPKFNIPQRKKIRC 457 >gb|EYU34610.1| hypothetical protein MIMGU_mgv1a023946mg [Mimulus guttatus] Length = 475 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 291 IPKRSDKHPTIPKDPKFNLPQQKKIKCYLSMDD 193 +P+RS K+PTIPK+PKF+LPQ KKIKC +S+DD Sbjct: 436 MPRRSMKNPTIPKEPKFHLPQHKKIKCDMSLDD 468 >gb|AAG51320.1|AC067753_1 hypothetical protein; 557-2776 [Arabidopsis thaliana] Length = 488 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -1 Query: 291 IPKRSDKHPTIPKDPKFNLPQQKKIKC 211 IPKRS+KHPT+P+DPKFN+PQ KKI+C Sbjct: 440 IPKRSNKHPTVPRDPKFNIPQHKKIRC 466 >ref|NP_186749.2| TPX2 (targeting protein for Xklp2) family protein [Arabidopsis thaliana] gi|52354295|gb|AAU44468.1| hypothetical protein AT3G01015 [Arabidopsis thaliana] gi|67633614|gb|AAY78731.1| hypothetical protein At3g01015 [Arabidopsis thaliana] gi|332640073|gb|AEE73594.1| TPX2 (targeting protein for Xklp2) family protein [Arabidopsis thaliana] Length = 488 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -1 Query: 291 IPKRSDKHPTIPKDPKFNLPQQKKIKC 211 IPKRS+KHPT+P+DPKFN+PQ KKI+C Sbjct: 440 IPKRSNKHPTVPRDPKFNIPQHKKIRC 466