BLASTX nr result
ID: Mentha27_contig00047295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047295 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300578.2| hypothetical protein POPTR_0001s47340g, part... 59 9e-07 ref|XP_007205089.1| hypothetical protein PRUPE_ppa014408mg [Prun... 56 6e-06 >ref|XP_002300578.2| hypothetical protein POPTR_0001s47340g, partial [Populus trichocarpa] gi|550350078|gb|EEE85383.2| hypothetical protein POPTR_0001s47340g, partial [Populus trichocarpa] Length = 127 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 3/42 (7%) Frame = -2 Query: 280 FEHGFHKLKDTLNYCDPSAAVS---GGAACGRPFLGFPAPPP 164 F++GFHKLKD L+ CDP+A S GG RPFLGFPAPPP Sbjct: 83 FKNGFHKLKDHLDVCDPNAIGSFCGGGGKASRPFLGFPAPPP 124 >ref|XP_007205089.1| hypothetical protein PRUPE_ppa014408mg [Prunus persica] gi|462400731|gb|EMJ06288.1| hypothetical protein PRUPE_ppa014408mg [Prunus persica] Length = 70 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/40 (55%), Positives = 31/40 (77%) Frame = -2 Query: 280 FEHGFHKLKDTLNYCDPSAAVSGGAACGRPFLGFPAPPPY 161 F++GFHK+KDT+N+CDP+ S + GRPFLG+ AP P+ Sbjct: 31 FKNGFHKIKDTVNFCDPNVHGSYCGSTGRPFLGYTAPAPF 70