BLASTX nr result
ID: Mentha27_contig00047230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00047230 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39729.1| hypothetical protein MIMGU_mgv1a004960mg [Mimulus... 63 5e-08 >gb|EYU39729.1| hypothetical protein MIMGU_mgv1a004960mg [Mimulus guttatus] Length = 502 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 242 KTSIHLFQIQSYLITSGLFQDPSFAGRLLKLSSNLITDL 358 + IHLFQIQ+ LITSG+FQDPSF+GRLLKLSS+LI DL Sbjct: 14 RNKIHLFQIQAQLITSGVFQDPSFSGRLLKLSSSLIDDL 52