BLASTX nr result
ID: Mentha27_contig00046916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00046916 (460 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO49655.1| putative auxin efflux carrier protein [Vigna ang... 116 4e-24 ref|XP_007162070.1| hypothetical protein PHAVU_001G121100g [Phas... 116 4e-24 ref|XP_004493383.1| PREDICTED: probable auxin efflux carrier com... 116 4e-24 ref|NP_001276315.1| uncharacterized protein LOC100802041 [Glycin... 116 4e-24 ref|XP_007204212.1| hypothetical protein PRUPE_ppa003159mg [Prun... 116 4e-24 ref|XP_004144328.1| PREDICTED: probable auxin efflux carrier com... 116 4e-24 ref|XP_002282640.2| PREDICTED: probable auxin efflux carrier com... 116 4e-24 ref|NP_001267492.1| uncharacterized protein LOC100820506 [Glycin... 116 4e-24 dbj|BAJ10464.1| auxin efflux facilitator [Cucumis sativus] 116 4e-24 emb|CBI32787.3| unnamed protein product [Vitis vinifera] 116 4e-24 ref|XP_002282701.1| PREDICTED: probable auxin efflux carrier com... 116 4e-24 ref|XP_002282693.1| PREDICTED: probable auxin efflux carrier com... 116 4e-24 ref|XP_002282687.1| PREDICTED: probable auxin efflux carrier com... 116 4e-24 ref|XP_002282661.1| PREDICTED: probable auxin efflux carrier com... 116 4e-24 ref|XP_002282650.1| PREDICTED: probable auxin efflux carrier com... 116 4e-24 ref|XP_002282669.1| PREDICTED: probable auxin efflux carrier com... 116 4e-24 emb|CBI32786.3| unnamed protein product [Vitis vinifera] 116 4e-24 emb|CAH60725.1| putative plasma membrane intrinsic protein [Popu... 116 4e-24 ref|XP_003624952.1| Auxin efflux carrier component [Medicago tru... 116 4e-24 gb|EYU18610.1| hypothetical protein MIMGU_mgv1a003446mg [Mimulus... 115 5e-24 >dbj|BAO49655.1| putative auxin efflux carrier protein [Vigna angularis] Length = 586 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 528 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 586 >ref|XP_007162070.1| hypothetical protein PHAVU_001G121100g [Phaseolus vulgaris] gi|561035534|gb|ESW34064.1| hypothetical protein PHAVU_001G121100g [Phaseolus vulgaris] Length = 585 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 527 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 585 >ref|XP_004493383.1| PREDICTED: probable auxin efflux carrier component 1c-like [Cicer arietinum] Length = 591 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 532 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 590 >ref|NP_001276315.1| uncharacterized protein LOC100802041 [Glycine max] gi|481044574|gb|AGJ95069.1| PIN10a [Glycine max] Length = 555 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 497 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 555 >ref|XP_007204212.1| hypothetical protein PRUPE_ppa003159mg [Prunus persica] gi|462399743|gb|EMJ05411.1| hypothetical protein PRUPE_ppa003159mg [Prunus persica] Length = 597 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 539 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 597 >ref|XP_004144328.1| PREDICTED: probable auxin efflux carrier component 1c-like [Cucumis sativus] gi|449488241|ref|XP_004157978.1| PREDICTED: probable auxin efflux carrier component 1c-like [Cucumis sativus] Length = 596 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 538 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 596 >ref|XP_002282640.2| PREDICTED: probable auxin efflux carrier component 1c-like isoform 1 [Vitis vinifera] Length = 619 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 561 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 619 >ref|NP_001267492.1| uncharacterized protein LOC100820506 [Glycine max] gi|481044536|gb|AGJ95050.1| PIN10b [Glycine max] Length = 597 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 539 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 597 >dbj|BAJ10464.1| auxin efflux facilitator [Cucumis sativus] Length = 596 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 538 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 596 >emb|CBI32787.3| unnamed protein product [Vitis vinifera] Length = 557 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 499 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 557 >ref|XP_002282701.1| PREDICTED: probable auxin efflux carrier component 1c-like isoform 3 [Vitis vinifera] Length = 600 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 542 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 600 >ref|XP_002282693.1| PREDICTED: probable auxin efflux carrier component 1c-like isoform 2 [Vitis vinifera] Length = 599 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 541 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 599 >ref|XP_002282687.1| PREDICTED: probable auxin efflux carrier component 1c-like isoform 1 [Vitis vinifera] Length = 591 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 533 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 591 >ref|XP_002282661.1| PREDICTED: probable auxin efflux carrier component 1c-like isoform 3 [Vitis vinifera] Length = 604 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 546 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 604 >ref|XP_002282650.1| PREDICTED: probable auxin efflux carrier component 1c-like isoform 2 [Vitis vinifera] Length = 597 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 539 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 597 >ref|XP_002282669.1| PREDICTED: probable auxin efflux carrier component 1c-like isoform 4 [Vitis vinifera] Length = 611 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 553 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 611 >emb|CBI32786.3| unnamed protein product [Vitis vinifera] Length = 555 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 497 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 555 >emb|CAH60725.1| putative plasma membrane intrinsic protein [Populus tremula x Populus tremuloides] Length = 372 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 314 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 372 >ref|XP_003624952.1| Auxin efflux carrier component [Medicago truncatula] gi|49035700|gb|AAT48630.1| putative auxin efflux carrier protein 10 [Medicago truncatula] gi|355499967|gb|AES81170.1| Auxin efflux carrier component [Medicago truncatula] Length = 591 Score = 116 bits (290), Expect = 4e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL Sbjct: 533 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 591 >gb|EYU18610.1| hypothetical protein MIMGU_mgv1a003446mg [Mimulus guttatus] Length = 584 Score = 115 bits (289), Expect = 5e-24 Identities = 57/59 (96%), Positives = 59/59 (100%) Frame = -2 Query: 456 LRGVLLHIAIVQASLPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 280 LRGVLLHIAIVQA+LPQGIVPFVFAKEYNVHPDILSTGVIFGML+ALPITLVYYILLGL Sbjct: 526 LRGVLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLVALPITLVYYILLGL 584