BLASTX nr result
ID: Mentha27_contig00046878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00046878 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003609027.1| Pentatricopeptide repeat-containing protein ... 98 1e-18 gb|EXC18345.1| hypothetical protein L484_005698 [Morus notabilis] 94 2e-17 gb|EXC07109.1| hypothetical protein L484_001609 [Morus notabilis] 94 2e-17 ref|XP_004505735.1| PREDICTED: pentatricopeptide repeat-containi... 94 3e-17 ref|XP_002512435.1| pentatricopeptide repeat-containing protein,... 94 3e-17 ref|XP_007157301.1| hypothetical protein PHAVU_002G058500g [Phas... 92 6e-17 ref|XP_006382397.1| hypothetical protein POPTR_0005s01750g [Popu... 91 1e-16 ref|XP_003537787.1| PREDICTED: pentatricopeptide repeat-containi... 90 3e-16 ref|XP_007204036.1| hypothetical protein PRUPE_ppa020827mg [Prun... 90 4e-16 ref|XP_004289096.1| PREDICTED: pentatricopeptide repeat-containi... 89 5e-16 ref|XP_006344758.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 ref|XP_006472193.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 ref|XP_006433532.1| hypothetical protein CICLE_v10003346mg [Citr... 88 1e-15 ref|XP_004231292.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 ref|XP_002277942.2| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 emb|CBI39592.3| unnamed protein product [Vitis vinifera] 85 9e-15 ref|XP_004144813.1| PREDICTED: pentatricopeptide repeat-containi... 85 1e-14 gb|EYU39304.1| hypothetical protein MIMGU_mgv1a003134mg [Mimulus... 84 2e-14 ref|XP_007031149.1| Pentatricopeptide repeat (PPR-like) superfam... 82 6e-14 ref|XP_007031148.1| Pentatricopeptide repeat (PPR-like) superfam... 82 6e-14 >ref|XP_003609027.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510082|gb|AES91224.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 583 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/77 (55%), Positives = 60/77 (77%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GFKLSL S N +L+ LV+ +IGD+E+ YKEM++ R+ +LNTFN+ ++GLC+AGKLNKA Sbjct: 160 GFKLSLTSCNPLLSALVKENKIGDVEYVYKEMIKRRIHTNLNTFNIFINGLCRAGKLNKA 219 Query: 52 SDIVEDMSVHRVNPNVV 2 D +EDM ++PNVV Sbjct: 220 EDAIEDMKAWGISPNVV 236 >gb|EXC18345.1| hypothetical protein L484_005698 [Morus notabilis] Length = 594 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/77 (58%), Positives = 57/77 (74%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GFKLS S N +L LV+ +IG +EF YKEM+R ++ DL TF++VV+GLCKAGKLNKA Sbjct: 177 GFKLSALSLNPLLCALVKENKIGQVEFVYKEMIRRKITGDLYTFSIVVNGLCKAGKLNKA 236 Query: 52 SDIVEDMSVHRVNPNVV 2 DI++DM V PNVV Sbjct: 237 GDIIQDMKAFGVLPNVV 253 >gb|EXC07109.1| hypothetical protein L484_001609 [Morus notabilis] Length = 595 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/77 (58%), Positives = 57/77 (74%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GFKLS S N +L LV+ +IG +EF YKEM+R ++ DL TF++VV+GLCKAGKLNKA Sbjct: 178 GFKLSALSLNPLLCALVKENKIGQVEFVYKEMIRRKITGDLYTFSIVVNGLCKAGKLNKA 237 Query: 52 SDIVEDMSVHRVNPNVV 2 DI++DM V PNVV Sbjct: 238 GDIIQDMKAFGVLPNVV 254 >ref|XP_004505735.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Cicer arietinum] Length = 586 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/76 (53%), Positives = 58/76 (76%) Frame = -2 Query: 229 FKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKAS 50 FKLSL S N +L+ LV+ +IGD+E+ Y EM++ + DLNTFN+ ++GLC+AGKLNKA Sbjct: 164 FKLSLTSCNPLLSALVKENKIGDMEYVYNEMMKRSIHPDLNTFNIFINGLCRAGKLNKAE 223 Query: 49 DIVEDMSVHRVNPNVV 2 D++EDM ++PNVV Sbjct: 224 DVIEDMKAWGLSPNVV 239 >ref|XP_002512435.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548396|gb|EEF49887.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 546 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/77 (55%), Positives = 59/77 (76%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 G KLS+ S N +++ LV+ G IGD+EF YKEM+R R++ L +FN+V++GLCK GKLNKA Sbjct: 123 GLKLSVTSCNPLMSGLVKVGEIGDMEFVYKEMIRRRIEPTLISFNIVINGLCKVGKLNKA 182 Query: 52 SDIVEDMSVHRVNPNVV 2 DI+EDM V V+ NV+ Sbjct: 183 GDIIEDMKVRGVSANVI 199 >ref|XP_007157301.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] gi|593788526|ref|XP_007157302.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] gi|593788528|ref|XP_007157303.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] gi|561030716|gb|ESW29295.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] gi|561030717|gb|ESW29296.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] gi|561030718|gb|ESW29297.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] Length = 583 Score = 92.4 bits (228), Expect = 6e-17 Identities = 40/77 (51%), Positives = 59/77 (76%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 G+K SL S NS+L+ LV+ G++E+ YKEM++ R++ +L TFN+ ++GLCKAGKLNKA Sbjct: 160 GYKSSLNSCNSLLSGLVKENETGEMEYVYKEMIKRRIQPNLTTFNIFINGLCKAGKLNKA 219 Query: 52 SDIVEDMSVHRVNPNVV 2 D++ED+ R +PNVV Sbjct: 220 EDVIEDIKAWRFSPNVV 236 >ref|XP_006382397.1| hypothetical protein POPTR_0005s01750g [Populus trichocarpa] gi|550337757|gb|ERP60194.1| hypothetical protein POPTR_0005s01750g [Populus trichocarpa] Length = 453 Score = 91.3 bits (225), Expect = 1e-16 Identities = 40/77 (51%), Positives = 61/77 (79%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GFKLSL S N +L+ LV+ GD+EF Y+EM++ ++++++ +FN+VV+GLCK GKLN+A Sbjct: 26 GFKLSLISCNPLLSGLVKESENGDMEFVYREMIKRKIELNVISFNIVVNGLCKVGKLNRA 85 Query: 52 SDIVEDMSVHRVNPNVV 2 D++EDM V V+PNV+ Sbjct: 86 GDVIEDMKVWGVSPNVI 102 >ref|XP_003537787.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Glycine max] Length = 583 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/77 (49%), Positives = 58/77 (75%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GFKLSL S N +L+ LV+ G++++ YKEM++ R++ +L TFN+ ++GLCKAGKLNKA Sbjct: 160 GFKLSLNSCNPLLSALVKGNETGEMQYVYKEMIKRRIQPNLTTFNIFINGLCKAGKLNKA 219 Query: 52 SDIVEDMSVHRVNPNVV 2 D++ED+ +PN+V Sbjct: 220 EDVIEDIKAWGFSPNIV 236 >ref|XP_007204036.1| hypothetical protein PRUPE_ppa020827mg [Prunus persica] gi|462399567|gb|EMJ05235.1| hypothetical protein PRUPE_ppa020827mg [Prunus persica] Length = 447 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/77 (53%), Positives = 57/77 (74%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GFKLS+ S N +L+ LV+ IG +E+ YKEM+R R++ DL TF++V++GLCK GKLNKA Sbjct: 26 GFKLSVLSCNPLLSALVKENEIGYVEYVYKEMVRRRIEADLFTFSIVINGLCKVGKLNKA 85 Query: 52 SDIVEDMSVHRVNPNVV 2 D+ DM ++PNVV Sbjct: 86 RDVTNDMKAWGISPNVV 102 >ref|XP_004289096.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Fragaria vesca subsp. vesca] Length = 608 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/77 (53%), Positives = 56/77 (72%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GF+LS S N++L+ LV+ G +EF YKEM+R R+ DL +FN+V++GLCK GKLNKA Sbjct: 186 GFRLSTLSCNALLSALVKENEFGYVEFVYKEMIRRRIAADLYSFNIVINGLCKVGKLNKA 245 Query: 52 SDIVEDMSVHRVNPNVV 2 D+++DM V PNVV Sbjct: 246 KDVMDDMKAWGVAPNVV 262 >ref|XP_006344758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like isoform X1 [Solanum tuberosum] gi|565355778|ref|XP_006344759.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like isoform X2 [Solanum tuberosum] Length = 605 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/77 (55%), Positives = 56/77 (72%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GFKLS+ S ML +V+ G+ E YKEM+R R++VDL TFN+V++GLCKAGKLNKA Sbjct: 182 GFKLSVFSCKPMLKGVVKEGKFEVGELVYKEMIRRRIEVDLYTFNIVINGLCKAGKLNKA 241 Query: 52 SDIVEDMSVHRVNPNVV 2 D++EDM V + PN V Sbjct: 242 RDVMEDMKVRGIMPNEV 258 >ref|XP_006472193.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like isoform X1 [Citrus sinensis] gi|568836322|ref|XP_006472194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like isoform X2 [Citrus sinensis] Length = 595 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/77 (54%), Positives = 58/77 (75%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 G K S+ S N +L LV+ G+ D+E+ YKEM R R++++L++FN V++GLCKAGKLNKA Sbjct: 172 GLKSSVLSCNQLLRALVKEGKFEDVEYVYKEMKRRRIELNLDSFNFVLNGLCKAGKLNKA 231 Query: 52 SDIVEDMSVHRVNPNVV 2 SDI+EDM V+P VV Sbjct: 232 SDIMEDMKSLGVSPKVV 248 >ref|XP_006433532.1| hypothetical protein CICLE_v10003346mg [Citrus clementina] gi|557535654|gb|ESR46772.1| hypothetical protein CICLE_v10003346mg [Citrus clementina] Length = 596 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/77 (54%), Positives = 58/77 (75%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 G K S+ S N +L LV+ G+ D+E+ YKEM R R++++L++FN V++GLCKAGKLNKA Sbjct: 173 GLKSSVLSCNQLLRALVKEGKFEDVEYVYKEMKRRRIELNLDSFNFVLNGLCKAGKLNKA 232 Query: 52 SDIVEDMSVHRVNPNVV 2 SDI+EDM V+P VV Sbjct: 233 SDIMEDMKSLGVSPKVV 249 >ref|XP_004231292.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Solanum lycopersicum] Length = 605 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/77 (55%), Positives = 56/77 (72%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GFKLS+ S ML +V+ G+ E YKEM+R R++VDL TFN+V++GLCKAGKLNKA Sbjct: 182 GFKLSVFSCKPMLKGVVKEGKFEVGELVYKEMIRRRIEVDLYTFNIVINGLCKAGKLNKA 241 Query: 52 SDIVEDMSVHRVNPNVV 2 D++EDM V + PN V Sbjct: 242 RDVMEDMKVRGIIPNEV 258 >ref|XP_002277942.2| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Vitis vinifera] Length = 609 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/77 (51%), Positives = 55/77 (71%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GF+LS S N ML LV+ GRIG +E YKEM+R R+ V++ TF++V++GLCK GK KA Sbjct: 189 GFRLSALSCNPMLVSLVKEGRIGVVESVYKEMIRRRIGVNVVTFDVVINGLCKVGKFQKA 248 Query: 52 SDIVEDMSVHRVNPNVV 2 D+VEDM +P+V+ Sbjct: 249 GDVVEDMKAWGFSPSVI 265 >emb|CBI39592.3| unnamed protein product [Vitis vinifera] Length = 577 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/77 (51%), Positives = 55/77 (71%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 GF+LS S N ML LV+ GRIG +E YKEM+R R+ V++ TF++V++GLCK GK KA Sbjct: 189 GFRLSALSCNPMLVSLVKEGRIGVVESVYKEMIRRRIGVNVVTFDVVINGLCKVGKFQKA 248 Query: 52 SDIVEDMSVHRVNPNVV 2 D+VEDM +P+V+ Sbjct: 249 GDVVEDMKAWGFSPSVI 265 >ref|XP_004144813.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Cucumis sativus] gi|449524964|ref|XP_004169491.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Cucumis sativus] Length = 611 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/76 (52%), Positives = 54/76 (71%) Frame = -2 Query: 229 FKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKAS 50 +KLS+ S N +L+ LV+ G +EF YKEM+R ++ +L TFN V++GLCK GKLNKA Sbjct: 191 YKLSVLSCNPLLSALVKENEFGGVEFVYKEMIRRKISPNLITFNTVINGLCKVGKLNKAG 250 Query: 49 DIVEDMSVHRVNPNVV 2 D+V+DM V PNVV Sbjct: 251 DVVDDMKVWGFWPNVV 266 >gb|EYU39304.1| hypothetical protein MIMGU_mgv1a003134mg [Mimulus guttatus] Length = 605 Score = 84.0 bits (206), Expect = 2e-14 Identities = 43/77 (55%), Positives = 56/77 (72%) Frame = -2 Query: 232 GFKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKA 53 G K SL S N ML+ L RIGD+EF YKEM+R ++ +L T+N V+SG KAGKLNKA Sbjct: 177 GLKPSLISCNPMLSALCNECRIGDVEFVYKEMVRRKLVPNLITYNTVISGFGKAGKLNKA 236 Query: 52 SDIVEDMSVHRVNPNVV 2 D+VE+M ++ V+PNVV Sbjct: 237 IDVVENMKINGVSPNVV 253 >ref|XP_007031149.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 2 [Theobroma cacao] gi|590644690|ref|XP_007031150.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 2 [Theobroma cacao] gi|508719754|gb|EOY11651.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 2 [Theobroma cacao] gi|508719755|gb|EOY11652.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 2 [Theobroma cacao] Length = 448 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/75 (48%), Positives = 56/75 (74%) Frame = -2 Query: 229 FKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKAS 50 FKLS+ S N +L+ LV+ IGD+++ YKEM+R RV+V++ +FN++++G+CK GKLNKA Sbjct: 27 FKLSVTSCNPLLSALVKENEIGDVDYVYKEMIRRRVEVNVISFNIIINGMCKVGKLNKAR 86 Query: 49 DIVEDMSVHRVNPNV 5 D ++DM P+V Sbjct: 87 DAIQDMKAWGFLPDV 101 >ref|XP_007031148.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508719753|gb|EOY11650.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 587 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/75 (48%), Positives = 56/75 (74%) Frame = -2 Query: 229 FKLSLRSFNSMLAELVRSGRIGDLEFAYKEMLRMRVKVDLNTFNMVVSGLCKAGKLNKAS 50 FKLS+ S N +L+ LV+ IGD+++ YKEM+R RV+V++ +FN++++G+CK GKLNKA Sbjct: 166 FKLSVTSCNPLLSALVKENEIGDVDYVYKEMIRRRVEVNVISFNIIINGMCKVGKLNKAR 225 Query: 49 DIVEDMSVHRVNPNV 5 D ++DM P+V Sbjct: 226 DAIQDMKAWGFLPDV 240