BLASTX nr result
ID: Mentha27_contig00046759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00046759 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44935.1| hypothetical protein MIMGU_mgv1a025726mg [Mimulus... 57 5e-08 >gb|EYU44935.1| hypothetical protein MIMGU_mgv1a025726mg [Mimulus guttatus] Length = 180 Score = 57.4 bits (137), Expect(2) = 5e-08 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = +1 Query: 94 KKKQTMIMQKHSGGGGGRRKPLISPTNNKSEEEVKLAALAISFNIRLRSADMPLPMQE 267 +K +++++ SG R S + + EEE+KLAALAISFNIRLRSADMP MQE Sbjct: 36 RKPLSVVVKTESGNTNNNRSDHRSRSRHLEEEEIKLAALAISFNIRLRSADMPSAMQE 93 Score = 25.4 bits (54), Expect(2) = 5e-08 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 300 LLDAAAAHRRPNP 338 LLDAAA RRPNP Sbjct: 102 LLDAAAPSRRPNP 114