BLASTX nr result
ID: Mentha27_contig00046598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00046598 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842155.1| hypothetical protein AMTR_s00078p00132750 [A... 75 7e-12 ref|XP_006420851.1| hypothetical protein CICLE_v10004140mg [Citr... 74 2e-11 ref|XP_006420850.1| hypothetical protein CICLE_v10004140mg [Citr... 74 2e-11 gb|EPS61923.1| hypothetical protein M569_12870 [Genlisea aurea] 74 2e-11 ref|XP_006587643.1| PREDICTED: transcription initiation factor T... 74 2e-11 ref|XP_006587642.1| PREDICTED: transcription initiation factor T... 74 2e-11 ref|XP_006578383.1| PREDICTED: transcription initiation factor T... 74 2e-11 ref|XP_006578382.1| PREDICTED: transcription initiation factor T... 74 2e-11 ref|XP_007158135.1| hypothetical protein PHAVU_002G127400g [Phas... 74 2e-11 ref|XP_003612586.1| Transcription initiation factor TFIID subuni... 74 2e-11 gb|EYU18432.1| hypothetical protein MIMGU_mgv1a000132mg [Mimulus... 74 3e-11 ref|XP_006494605.1| PREDICTED: transcription initiation factor T... 73 4e-11 ref|XP_006494604.1| PREDICTED: transcription initiation factor T... 73 4e-11 ref|XP_006366188.1| PREDICTED: transcription initiation factor T... 73 4e-11 ref|XP_006366187.1| PREDICTED: transcription initiation factor T... 73 4e-11 ref|XP_006366186.1| PREDICTED: transcription initiation factor T... 73 4e-11 ref|XP_006420854.1| hypothetical protein CICLE_v100041251mg, par... 73 4e-11 ref|XP_004242685.1| PREDICTED: transcription initiation factor T... 73 4e-11 ref|XP_002522626.1| transcription initiation factor tfiid, putat... 73 5e-11 ref|XP_004512374.1| PREDICTED: transcription initiation factor T... 72 8e-11 >ref|XP_006842155.1| hypothetical protein AMTR_s00078p00132750 [Amborella trichopoda] gi|548844204|gb|ERN03830.1| hypothetical protein AMTR_s00078p00132750 [Amborella trichopoda] Length = 2104 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD +GDLDVDYLDEDAKEHLSALADKLG SL Sbjct: 58 NRLLGFMFGNVDDSGDLDVDYLDEDAKEHLSALADKLGSSL 98 >ref|XP_006420851.1| hypothetical protein CICLE_v10004140mg [Citrus clementina] gi|557522724|gb|ESR34091.1| hypothetical protein CICLE_v10004140mg [Citrus clementina] Length = 1339 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD AGDLDVDYLDEDAKEHL+A+ADKLG SL Sbjct: 29 NRLLGFMFGNVDNAGDLDVDYLDEDAKEHLAAVADKLGPSL 69 >ref|XP_006420850.1| hypothetical protein CICLE_v10004140mg [Citrus clementina] gi|557522723|gb|ESR34090.1| hypothetical protein CICLE_v10004140mg [Citrus clementina] Length = 1594 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD AGDLDVDYLDEDAKEHL+A+ADKLG SL Sbjct: 29 NRLLGFMFGNVDNAGDLDVDYLDEDAKEHLAAVADKLGPSL 69 >gb|EPS61923.1| hypothetical protein M569_12870 [Genlisea aurea] Length = 188 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD +GDLDVDYLDEDAKEHL+ALADKLG SL Sbjct: 37 NRLLGFMFGNVDDSGDLDVDYLDEDAKEHLAALADKLGSSL 77 >ref|XP_006587643.1| PREDICTED: transcription initiation factor TFIID subunit 1-like isoform X2 [Glycine max] Length = 1877 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N GFMFGNVD +GDLDVDYLDEDAKEHLSALADKLG SL Sbjct: 28 NRFLGFMFGNVDNSGDLDVDYLDEDAKEHLSALADKLGPSL 68 >ref|XP_006587642.1| PREDICTED: transcription initiation factor TFIID subunit 1-like isoform X1 [Glycine max] Length = 1890 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N GFMFGNVD +GDLDVDYLDEDAKEHLSALADKLG SL Sbjct: 28 NRFLGFMFGNVDNSGDLDVDYLDEDAKEHLSALADKLGPSL 68 >ref|XP_006578383.1| PREDICTED: transcription initiation factor TFIID subunit 1-like isoform X2 [Glycine max] Length = 1848 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N GFMFGNVD +GDLDVDYLDEDAKEHLSALADKLG SL Sbjct: 28 NRFLGFMFGNVDNSGDLDVDYLDEDAKEHLSALADKLGPSL 68 >ref|XP_006578382.1| PREDICTED: transcription initiation factor TFIID subunit 1-like isoform X1 [Glycine max] Length = 1889 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N GFMFGNVD +GDLDVDYLDEDAKEHLSALADKLG SL Sbjct: 28 NRFLGFMFGNVDNSGDLDVDYLDEDAKEHLSALADKLGPSL 68 >ref|XP_007158135.1| hypothetical protein PHAVU_002G127400g [Phaseolus vulgaris] gi|561031550|gb|ESW30129.1| hypothetical protein PHAVU_002G127400g [Phaseolus vulgaris] Length = 1897 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N GFMFGNVD +GDLDVDYLDEDAKEHLSALADKLG SL Sbjct: 28 NRFLGFMFGNVDNSGDLDVDYLDEDAKEHLSALADKLGPSL 68 >ref|XP_003612586.1| Transcription initiation factor TFIID subunit 1-A [Medicago truncatula] gi|355513921|gb|AES95544.1| Transcription initiation factor TFIID subunit 1-A [Medicago truncatula] Length = 2196 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N GFMFGNVD +GDLDVDYLDEDAKEHLSALADKLG SL Sbjct: 124 NHFLGFMFGNVDNSGDLDVDYLDEDAKEHLSALADKLGPSL 164 >gb|EYU18432.1| hypothetical protein MIMGU_mgv1a000132mg [Mimulus guttatus] Length = 1687 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD +GDLDVDYLDEDAKEHL+ALADKLG SL Sbjct: 16 NRLLGFMFGNVDDSGDLDVDYLDEDAKEHLAALADKLGLSL 56 >ref|XP_006494605.1| PREDICTED: transcription initiation factor TFIID subunit 1-like isoform X1 [Citrus sinensis] gi|568883734|ref|XP_006494606.1| PREDICTED: transcription initiation factor TFIID subunit 1-like isoform X2 [Citrus sinensis] Length = 201 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD AGDLDVDYLDEDAKEHL+A+ADKLG SL Sbjct: 29 NRLLGFMFGNVDYAGDLDVDYLDEDAKEHLAAVADKLGPSL 69 >ref|XP_006494604.1| PREDICTED: transcription initiation factor TFIID subunit 1-like [Citrus sinensis] Length = 1944 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD AGDLDVDYLDEDAKEHL+A+ADKLG SL Sbjct: 29 NRLLGFMFGNVDYAGDLDVDYLDEDAKEHLAAVADKLGPSL 69 >ref|XP_006366188.1| PREDICTED: transcription initiation factor TFIID subunit 1-like isoform X3 [Solanum tuberosum] Length = 1856 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD +GDLDVDYLDEDAKEHL+ALADKLG SL Sbjct: 28 NRLLGFMFGNVDYSGDLDVDYLDEDAKEHLAALADKLGPSL 68 >ref|XP_006366187.1| PREDICTED: transcription initiation factor TFIID subunit 1-like isoform X2 [Solanum tuberosum] Length = 1857 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD +GDLDVDYLDEDAKEHL+ALADKLG SL Sbjct: 28 NRLLGFMFGNVDYSGDLDVDYLDEDAKEHLAALADKLGPSL 68 >ref|XP_006366186.1| PREDICTED: transcription initiation factor TFIID subunit 1-like isoform X1 [Solanum tuberosum] Length = 1858 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD +GDLDVDYLDEDAKEHL+ALADKLG SL Sbjct: 28 NRLLGFMFGNVDYSGDLDVDYLDEDAKEHLAALADKLGPSL 68 >ref|XP_006420854.1| hypothetical protein CICLE_v100041251mg, partial [Citrus clementina] gi|557522727|gb|ESR34094.1| hypothetical protein CICLE_v100041251mg, partial [Citrus clementina] Length = 88 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD AGDLDVDYLDEDAKEHL+A+ADKLG SL Sbjct: 29 NRLLGFMFGNVDYAGDLDVDYLDEDAKEHLAAVADKLGPSL 69 >ref|XP_004242685.1| PREDICTED: transcription initiation factor TFIID subunit 1-A-like [Solanum lycopersicum] Length = 1856 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 149 NSLFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 N L GFMFGNVD +GDLDVDYLDEDAKEHL+ALADKLG SL Sbjct: 28 NRLLGFMFGNVDYSGDLDVDYLDEDAKEHLAALADKLGPSL 68 >ref|XP_002522626.1| transcription initiation factor tfiid, putative [Ricinus communis] gi|223538102|gb|EEF39713.1| transcription initiation factor tfiid, putative [Ricinus communis] Length = 1885 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +2 Query: 155 LFGFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 L GFMFGNVD +GDLDVDYLDEDAKEHL+ALADKLG SL Sbjct: 31 LLGFMFGNVDNSGDLDVDYLDEDAKEHLAALADKLGSSL 69 >ref|XP_004512374.1| PREDICTED: transcription initiation factor TFIID subunit 1-A-like isoform X3 [Cicer arietinum] Length = 1883 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 161 GFMFGNVDGAGDLDVDYLDEDAKEHLSALADKLGHSL 271 GFMFGNVD +GDLDVDYLDEDAKEHLSALADKLG SL Sbjct: 32 GFMFGNVDNSGDLDVDYLDEDAKEHLSALADKLGPSL 68